Property Summary

NCBI Gene PubMed Count 27
PubMed Score 55.95
PubTator Score 39.33

Knowledge Summary


No data available


  Differential Expression (9)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.200 7.0e-05
glioblastoma -1.300 2.8e-05
medulloblastoma, large-cell -1.400 3.5e-04
juvenile dermatomyositis -1.037 6.6e-12
adult high grade glioma -1.300 7.5e-04
group 4 medulloblastoma -1.200 9.8e-04
non primary Sjogren syndrome sicca 1.100 1.8e-02
ovarian cancer -1.100 2.2e-05
psoriasis -2.600 9.6e-155

Gene RIF (24)

26754294 miR-28-5p-IL-34-macrophage feedback loop modulates hepatocellular carcinoma metastasis
26389674 IL-34 is expressed by human FOXP3+CD45RCloCD8+ and CD4+ Tregs and markedly inhibited alloreactive immune responses.
26095744 findings demonstrated that M-CSF binds to IL-34; molecular docking studies predicted the formation of a heteromeric M-CSF/IL-34 cytokine
25896238 the expression pattern of IL-34 in ileum and colon and suggest IL-34 as a new modulator of inflammation in inflammatory bowel disease
25800277 IL-34 is up-regulated in inflammatory bowel disease and suggest a role for this cytokine in sustaining the inflammatory responses in this disease
25662098 This paper provides evidence of alternative binding of IL-34 to chondroitin sulphates and syndecan-1 at the cell surface that modulates M-CSFR activation.
25471534 In vitro and in vivo experiments indicate that IL-34 expression is regulated by TNF-a and IL-1b and that its overexpression is associated with an increase in osteosarcoma growth and metastasis.
25415279 IL-34 is induced by IL-22 in the inflammatory cascade in response to IAV infection.
25066464 potent profibrotic factor in hepatitis C virus liver fibrosis
25027626 These results suggest that IL-34, a novel osteoclastogenic cytokine, plays a role in rheumatoid arthritis-associated joint damage and is a potential biomarker for predicting subsequent radiographic progression in patients with RA.
24737461 IL-34 promotes the development, survival, and function of microglia and Langerhans cells; therefore, this cytokine may predominately function in brain and skin biology.[review]
24712570 IL-34 is associated with insulin resistance.
24339952 IL-34 expression in human gingival fibroblasts, stimulated by TNF-alpha and IL-1beta
23996288 Circulating IL-34 levels in rheumatoid arthritis correlated with autoantibody production.
23744080 Data suggest that CSF-1R-independent actions of IL-34 via receptor-type protein-tyrosine phosphatase zeta (PTP-zeta) might be considered in evaluating IL-34 roles in development and disease.
23684409 This study is the first to illustrate downstream transcriptional profiles and pathways of IL-34 in comparison with CSF-1 and identify notable differences in CCR2 expression.
23421370 These findings suggest that IL-34 may play a role in the pathogenesis of rheumatoid arthritis.
23260168 the feline CSF-1R was cloned and the responsiveness to CSF-1 and IL-34 from a range of species, was examined.
23206468 IL-34 levels were significantly increased in patients with coronary artery disease (CAD), and positively correlated with hs-CRP levels, suggesting that IL-34 may be an independent predictor of CAD.
23177320 IL-34 as a nonredundant cytokine for the development of Langerhans cells during embryogenesis as well as for their homeostasis in the adult skin.
22264405 Data suggest a discrete role of IL-34 in inflammatory rheumatoid arthritis (RA) diseases.
22039170 study identifies IL-34 expression in the synovial tissue of patients with arthritis; this cytokine, as a downstream effector of TNFalpha and IL-1beta, may contribute to inflammation and bone erosions in rheumatoid arthritis
20504948 The different spatiotemporal expression of IL-34 and CSF-1 allows for complementary activation of the CSF-1R in developing and adult tissues.
18467591 Discovered IL-34 and its receptor CSF1 by functional screening of the extracellular proteome.

AA Sequence

QLYPPPPWSPSSPPHSTGSVRPVRAQGEGLLP                                          211 - 242

Text Mined References (32)

PMID Year Title
26754294 2016 miR-28-5p-IL-34-macrophage feedback loop modulates hepatocellular carcinoma metastasis.
26389674 2015 IL-34 is a Treg-specific cytokine and mediates transplant tolerance.
26095744 2015 IL-34 and M-CSF form a novel heteromeric cytokine and regulate the M-CSF receptor activation and localization.
25896238 2015 Interleukin 34: a new modulator of human and experimental inflammatory bowel disease.
25800277 2015 Interleukin-34 sustains inflammatory pathways in the gut.
25662098 2015 Syndecan-1 regulates the biological activities of interleukin-34.
25471534 2015 Interleukin-34 promotes tumor progression and metastatic process in osteosarcoma through induction of angiogenesis and macrophage recruitment.
25415279 2015 Activation of the interleukin-34 inflammatory pathway in response to influenza A virus infection.
25066464 2014 IL-34 and macrophage colony-stimulating factor are overexpressed in hepatitis C virus fibrosis and induce profibrotic macrophages that promote collagen synthesis by hepatic stellate cells.
25027626 2015 Baseline serum interleukin-34 levels independently predict radiographic progression in patients with rheumatoid arthritis.
24737461 2014 Interkeukin-34, a cytokine crucial for the differentiation and maintenance of tissue resident macrophages and Langerhans cells.
24712570 2014 IL-34 is associated with obesity, chronic inflammation, and insulin resistance.
24339952 2013 The newly discovered cytokine IL-34 is expressed in gingival fibroblasts, shows enhanced expression by pro-inflammatory cytokines, and stimulates osteoclast differentiation.
23996288 2013 Increased levels of interleukin 34 in serum and synovial fluid are associated with rheumatoid factor and anticyclic citrullinated peptide antibody titers in patients with rheumatoid arthritis.
23744080 2013 Receptor-type protein-tyrosine phosphatase ? is a functional receptor for interleukin-34.
23684409 2013 Transcriptional profiling and pathway analysis of CSF-1 and IL-34 effects on human monocyte differentiation.
23421370 2013 Elevated serum and synovial fluid levels of interleukin-34 in rheumatoid arthritis: possible association with disease progression via interleukin-17 production.
23409120 2013 IL-34 induces the differentiation of human monocytes into immunosuppressive macrophages. antagonistic effects of GM-CSF and IFN?.
23260168 2013 Cloning and expression of feline colony stimulating factor receptor (CSF-1R) and analysis of the species specificity of stimulation by colony stimulating factor-1 (CSF-1) and interleukin-34 (IL-34).
23206468 2012 Increased serum interleukin-34 in patients with coronary artery disease.
23177320 2012 Stroma-derived interleukin-34 controls the development and maintenance of langerhans cells and the maintenance of microglia.
22264405 2012 Interleukin-34 produced by human fibroblast-like synovial cells in rheumatoid arthritis supports osteoclastogenesis.
22039170 2012 Interleukin 34 expression is associated with synovitis severity in rheumatoid arthritis patients.
20829061 2010 Macrophage-colony stimulating factor and interleukin-34 induce chemokines in human whole blood.
20504948 2010 Functional overlap but differential expression of CSF-1 and IL-34 in their CSF-1 receptor-mediated regulation of myeloid cells.
20489731 2010 IL-34 and M-CSF share the receptor Fms but are not identical in biological activity and signal activation.
18467591 2008 Discovery of a cytokine and its receptor by functional screening of the extracellular proteome.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.