Property Summary

NCBI Gene PubMed Count 27
PubMed Score 55.95
PubTator Score 39.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Polycystic Ovary Syndrome 335
Disease Target Count P-value
psoriasis 6685 9.55499773434778E-155
juvenile dermatomyositis 1189 6.6353347776071E-12
ovarian cancer 8492 2.16752389666267E-5
glioblastoma 5572 2.80727428460653E-5
atypical teratoid / rhabdoid tumor 4369 6.95126756947729E-5
medulloblastoma, large-cell 6234 3.49226671662652E-4
adult high grade glioma 2148 7.51823537875738E-4
group 4 medulloblastoma 1875 9.84366950426735E-4
non primary Sjogren syndrome sicca 840 0.0178963094983566
Disease Target Count Z-score Confidence
Chronic apical periodontitis 3 3.284 1.6
Rheumatoid Arthritis 1171 3.264 1.6

Expression

  Differential Expression (9)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.200 0.000
glioblastoma -1.300 0.000
medulloblastoma, large-cell -1.400 0.000
juvenile dermatomyositis -1.037 0.000
adult high grade glioma -1.300 0.001
group 4 medulloblastoma -1.200 0.001
non primary Sjogren syndrome sicca 1.100 0.018
ovarian cancer -1.100 0.000
psoriasis -2.600 0.000

Synonym

Accession Q6ZMJ4 B2RC28 B2Z4A8 B2ZC70 Q8N6L2 IL-34
Symbols IL-34
C16orf77

Gene

PDB

4DKC   4DKD   4DKE   4DKF  

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Platypus OMA EggNOG

Gene RIF (24)

PMID Text
26754294 miR-28-5p-IL-34-macrophage feedback loop modulates hepatocellular carcinoma metastasis
26389674 IL-34 is expressed by human FOXP3+CD45RCloCD8+ and CD4+ Tregs and markedly inhibited alloreactive immune responses.
26095744 findings demonstrated that M-CSF binds to IL-34; molecular docking studies predicted the formation of a heteromeric M-CSF/IL-34 cytokine
25896238 the expression pattern of IL-34 in ileum and colon and suggest IL-34 as a new modulator of inflammation in inflammatory bowel disease
25800277 IL-34 is up-regulated in inflammatory bowel disease and suggest a role for this cytokine in sustaining the inflammatory responses in this disease
25662098 This paper provides evidence of alternative binding of IL-34 to chondroitin sulphates and syndecan-1 at the cell surface that modulates M-CSFR activation.
25471534 In vitro and in vivo experiments indicate that IL-34 expression is regulated by TNF-a and IL-1b and that its overexpression is associated with an increase in osteosarcoma growth and metastasis.
25415279 IL-34 is induced by IL-22 in the inflammatory cascade in response to IAV infection.
25066464 potent profibrotic factor in hepatitis C virus liver fibrosis
25027626 These results suggest that IL-34, a novel osteoclastogenic cytokine, plays a role in rheumatoid arthritis-associated joint damage and is a potential biomarker for predicting subsequent radiographic progression in patients with RA.
More...

AA Sequence

MPRGFTWLRYLGIFLGVALGNEPLEMWPLTQNEECTVTGFLRDKLQYRSRLQYMKHYFPINYKISVPYEG      1 - 70
VFRIANVTRLQRAQVSERELRYLWVLVSLSATESVQDVLLEGHPSWKYLQEVETLLLNVQQGLTDVEVSP     71 - 140
KVESVLSLLNAPGPNLKLVRPKALLDNCFRVMELLYCSCCKQSSVLNWQDCEVPSPQSCSPEPSLQYAAT    141 - 210
QLYPPPPWSPSSPPHSTGSVRPVRAQGEGLLP                                          211 - 242
//

Text Mined References (32)

PMID Year Title
26754294 2016 miR-28-5p-IL-34-macrophage feedback loop modulates hepatocellular carcinoma metastasis.
26389674 2015 IL-34 is a Treg-specific cytokine and mediates transplant tolerance.
26095744 2015 IL-34 and M-CSF form a novel heteromeric cytokine and regulate the M-CSF receptor activation and localization.
25896238 2015 Interleukin 34: a new modulator of human and experimental inflammatory bowel disease.
25800277 2015 Interleukin-34 sustains inflammatory pathways in the gut.
25662098 2015 Syndecan-1 regulates the biological activities of interleukin-34.
25471534 2015 Interleukin-34 promotes tumor progression and metastatic process in osteosarcoma through induction of angiogenesis and macrophage recruitment.
25415279 2015 Activation of the interleukin-34 inflammatory pathway in response to influenza A virus infection.
25066464 2014 IL-34 and macrophage colony-stimulating factor are overexpressed in hepatitis C virus fibrosis and induce profibrotic macrophages that promote collagen synthesis by hepatic stellate cells.
25027626 2015 Baseline serum interleukin-34 levels independently predict radiographic progression in patients with rheumatoid arthritis.
More...