Property Summary

NCBI Gene PubMed Count 27
Grant Count 15
R01 Count 5
Funding $1,598,678.91
PubMed Score 55.95
PubTator Score 39.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.200 0.000
glioblastoma -1.300 0.000
medulloblastoma, large-cell -1.400 0.000
juvenile dermatomyositis -1.037 0.000
adult high grade glioma -1.300 0.001
group 4 medulloblastoma -1.200 0.001
non primary Sjogren syndrome sicca 1.100 0.018
ovarian cancer -1.100 0.000
psoriasis -2.600 0.000

Gene RIF (24)

PMID Text
26754294 miR-28-5p-IL-34-macrophage feedback loop modulates hepatocellular carcinoma metastasis
26389674 IL-34 is expressed by human FOXP3+CD45RCloCD8+ and CD4+ Tregs and markedly inhibited alloreactive immune responses.
26095744 findings demonstrated that M-CSF binds to IL-34; molecular docking studies predicted the formation of a heteromeric M-CSF/IL-34 cytokine
25896238 the expression pattern of IL-34 in ileum and colon and suggest IL-34 as a new modulator of inflammation in inflammatory bowel disease
25800277 IL-34 is up-regulated in inflammatory bowel disease and suggest a role for this cytokine in sustaining the inflammatory responses in this disease
25662098 This paper provides evidence of alternative binding of IL-34 to chondroitin sulphates and syndecan-1 at the cell surface that modulates M-CSFR activation.
25471534 In vitro and in vivo experiments indicate that IL-34 expression is regulated by TNF-a and IL-1b and that its overexpression is associated with an increase in osteosarcoma growth and metastasis.
25415279 IL-34 is induced by IL-22 in the inflammatory cascade in response to IAV infection.
25066464 potent profibrotic factor in hepatitis C virus liver fibrosis
25027626 These results suggest that IL-34, a novel osteoclastogenic cytokine, plays a role in rheumatoid arthritis-associated joint damage and is a potential biomarker for predicting subsequent radiographic progression in patients with RA.
More...

AA Sequence

MPRGFTWLRYLGIFLGVALGNEPLEMWPLTQNEECTVTGFLRDKLQYRSRLQYMKHYFPINYKISVPYEG      1 - 70
VFRIANVTRLQRAQVSERELRYLWVLVSLSATESVQDVLLEGHPSWKYLQEVETLLLNVQQGLTDVEVSP     71 - 140
KVESVLSLLNAPGPNLKLVRPKALLDNCFRVMELLYCSCCKQSSVLNWQDCEVPSPQSCSPEPSLQYAAT    141 - 210
QLYPPPPWSPSSPPHSTGSVRPVRAQGEGLLP                                          211 - 242
//

Text Mined References (32)

PMID Year Title
26754294 2016 miR-28-5p-IL-34-macrophage feedback loop modulates hepatocellular carcinoma metastasis.
26389674 2015 IL-34 is a Treg-specific cytokine and mediates transplant tolerance.
26095744 2015 IL-34 and M-CSF form a novel heteromeric cytokine and regulate the M-CSF receptor activation and localization.
25896238 2015 Interleukin 34: a new modulator of human and experimental inflammatory bowel disease.
25800277 2015 Interleukin-34 sustains inflammatory pathways in the gut.
25662098 2015 Syndecan-1 regulates the biological activities of interleukin-34.
25471534 2015 Interleukin-34 promotes tumor progression and metastatic process in osteosarcoma through induction of angiogenesis and macrophage recruitment.
25415279 2015 Activation of the interleukin-34 inflammatory pathway in response to influenza A virus infection.
25066464 2014 IL-34 and macrophage colony-stimulating factor are overexpressed in hepatitis C virus fibrosis and induce profibrotic macrophages that promote collagen synthesis by hepatic stellate cells.
25027626 2015 Baseline serum interleukin-34 levels independently predict radiographic progression in patients with rheumatoid arthritis.
More...