Property Summary

NCBI Gene PubMed Count 32
PubMed Score 72.98
PubTator Score 39.33

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (9)

Disease log2 FC p
adult high grade glioma -1.300 7.5e-04
atypical teratoid / rhabdoid tumor -1.200 7.0e-05
glioblastoma -1.300 2.8e-05
group 4 medulloblastoma -1.200 9.8e-04
juvenile dermatomyositis -1.037 6.6e-12
medulloblastoma, large-cell -1.400 3.5e-04
non primary Sjogren syndrome sicca 1.100 1.8e-02
ovarian cancer -1.100 2.2e-05
psoriasis -2.600 9.6e-155

Gene RIF (29)

AA Sequence

MPRGFTWLRYLGIFLGVALGNEPLEMWPLTQNEECTVTGFLRDKLQYRSRLQYMKHYFPINYKISVPYEG      1 - 70
VFRIANVTRLQRAQVSERELRYLWVLVSLSATESVQDVLLEGHPSWKYLQEVETLLLNVQQGLTDVEVSP     71 - 140
KVESVLSLLNAPGPNLKLVRPKALLDNCFRVMELLYCSCCKQSSVLNWQDCEVPSPQSCSPEPSLQYAAT    141 - 210
QLYPPPPWSPSSPPHSTGSVRPVRAQGEGLLP                                          211 - 242
//

Text Mined References (37)

PMID Year Title