Property Summary

NCBI Gene PubMed Count 20
PubMed Score 26.17
PubTator Score 11.37

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
Atopic dermatitis -3.100 1.6e-04
Breast cancer -3.100 3.0e-02
breast carcinoma -2.900 3.0e-06
ductal carcinoma in situ -3.400 3.6e-04
Endometriosis -1.570 1.9e-02
ependymoma -1.100 3.5e-02
fascioscapulohumeral muscular dystrophy 1.018 4.0e-05
fibroadenoma -2.300 5.0e-03
intraductal papillary-mucinous adenoma (... -1.700 1.9e-02
intraductal papillary-mucinous neoplasm ... -2.300 2.8e-02
invasive ductal carcinoma -3.517 1.5e-06
lung adenocarcinoma -1.900 7.4e-09
non-small cell lung cancer -3.241 4.9e-27
ovarian cancer -1.600 3.5e-11
pituitary cancer -1.500 2.8e-02
psoriasis -1.200 3.9e-16

Gene RIF (10)

AA Sequence

MENKAMYLHTVSDCDTSSICEDSFDGRSLSKLNLCEDGPCHKRRASICCTQLGSLSALKHAVLGLYLLVF      1 - 70
LILVGIFILAVSRPRSSPDDLKALTRNVNRLNESFRDLQLRLLQAPLQADLTEQVWKVQDALQNQSDSLL     71 - 140
ALAGAVQRLEGALWGLQAQAVQTEQAVALLRDRTGQQSDTAQLELYQLQVESNSSQLLLRRHAGLLDGLA    141 - 210
RRVGILGEELADVGGVLRGLNHSLSYDVALHRTRLQDLRVLVSNASEDTRRLRLAHVGMELQLKQELAML    211 - 280
NAVTEDLRLKDWEHSIALRNISLAKGPPGPKGDQGDEGKEGRPGIPGLPGLRGLPGERGTPGLPGPKGDD    281 - 350
GKLGATGPMGMRGFKGDRGPKGEKGEKGDRAGDASGVEAPMMIRLVNGSGPHEGRVEVYHDRRWGTVCDD    351 - 420
GWDKKDGDVVCRMLGFRGVEEVYRTARFGQGTGRIWMDDVACKGTEETIFRCSFSKWGVTNCGHAEDASV    421 - 490
TCNRH                                                                     491 - 495
//

Text Mined References (20)

PMID Year Title