Property Summary

NCBI Gene PubMed Count 15
PubMed Score 21.55
PubTator Score 11.37

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
ependymoma -1.100 0.035
fascioscapulohumeral muscular dystrophy 1.018 0.000
Atopic dermatitis -3.100 0.000
non-small cell lung cancer -3.241 0.000
intraductal papillary-mucinous adenoma (... -1.700 0.019
intraductal papillary-mucinous neoplasm ... -2.300 0.028
breast carcinoma -2.900 0.000
fibroadenoma -2.300 0.005
non-inflammatory breast cancer -4.000 0.000
psoriasis -1.500 0.000
lung adenocarcinoma -1.900 0.000
invasive ductal carcinoma -4.700 0.000
Endometriosis -1.570 0.019
ductal carcinoma in situ -3.400 0.000
ovarian cancer -1.600 0.000
pituitary cancer -1.500 0.028

Synonym

Accession Q6ZMJ2 Q6UXZ1 Q7Z4A1 Q8N4Z7
Symbols Tesr
NET33

Gene

Gene RIF (5)

PMID Text
25259650 Scara5 was downregulated, pointing out this receptor as a potential player implicated in retinopathy and also as a possible therapeutic target.
22138034 Results demonstrate the involvement of SCARA3 and SCARA5 in the uptake of PF14-oligonucleotide nanocomplexes.
21858178 Data show that decidualization was associated with increased expression of 428 genes including SCARA5 (181-fold), DKK1 (71-fold) and PROK1 (32-fold), and decreased expression of 230 genes including MMP-7 (35-fold) and SFRP4 (21-fold).
21029358 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MENKAMYLHTVSDCDTSSICEDSFDGRSLSKLNLCEDGPCHKRRASICCTQLGSLSALKHAVLGLYLLVF      1 - 70
LILVGIFILAVSRPRSSPDDLKALTRNVNRLNESFRDLQLRLLQAPLQADLTEQVWKVQDALQNQSDSLL     71 - 140
ALAGAVQRLEGALWGLQAQAVQTEQAVALLRDRTGQQSDTAQLELYQLQVESNSSQLLLRRHAGLLDGLA    141 - 210
RRVGILGEELADVGGVLRGLNHSLSYDVALHRTRLQDLRVLVSNASEDTRRLRLAHVGMELQLKQELAML    211 - 280
NAVTEDLRLKDWEHSIALRNISLAKGPPGPKGDQGDEGKEGRPGIPGLPGLRGLPGERGTPGLPGPKGDD    281 - 350
GKLGATGPMGMRGFKGDRGPKGEKGEKGDRAGDASGVEAPMMIRLVNGSGPHEGRVEVYHDRRWGTVCDD    351 - 420
GWDKKDGDVVCRMLGFRGVEEVYRTARFGQGTGRIWMDDVACKGTEETIFRCSFSKWGVTNCGHAEDASV    421 - 490
TCNRH                                                                     491 - 495
//

Text Mined References (15)

PMID Year Title
25259650 2014 L-ferritin binding to scara5: a new iron traffic pathway potentially implicated in retinopathy.
23648065 2013 Genome-wide association study of chemotherapeutic agent-induced severe neutropenia/leucopenia for patients in Biobank Japan.
22138034 2012 Scavenger receptor-mediated uptake of cell-penetrating peptide nanocomplexes with oligonucleotides.
21858178 2011 Ectopic pregnancy as a model to identify endometrial genes and signaling pathways important in decidualization and regulated by local trophoblast.
21810271 2011 Combined analysis of three genome-wide association studies on vWF and FVIII plasma levels.
21029358 2011 Impact on venous thrombosis risk of newly discovered gene variants associated with FVIII and VWF plasma levels.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19154717 2009 Scara5 is a ferritin receptor mediating non-transferrin iron delivery.
16407294 2006 Identification and characterization of murine SCARA5, a novel class A scavenger receptor that is expressed by populations of epithelial cells.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
More...