Property Summary

NCBI Gene PubMed Count 14
PubMed Score 42.83
PubTator Score 9.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
adrenocortical carcinoma -1.301 2.7e-02
Atopic dermatitis -1.700 2.2e-03
atypical teratoid / rhabdoid tumor -1.600 2.7e-03
ductal carcinoma in situ -2.100 1.4e-03
ependymoma -3.400 2.5e-02
fibroadenoma -1.100 3.5e-02
group 4 medulloblastoma -1.800 1.5e-02
invasive ductal carcinoma -2.500 5.8e-03
lung adenocarcinoma -1.300 2.2e-08
lung carcinoma -3.000 2.5e-19
non-small cell lung cancer -3.177 1.1e-29
oligodendroglioma -1.200 1.3e-05
osteosarcoma -2.777 3.0e-03
ovarian cancer 1.700 1.8e-05
Pick disease -2.300 7.6e-03
progressive supranuclear palsy -2.200 2.8e-02
sarcoidosis -1.900 1.6e-02

Gene RIF (3)

AA Sequence

MARGAEGGRGDAGWGLRGALAAVALLSALNAAGTVFALCQWRGLSSALRALEAQRGREQREDSALRSFLA      1 - 70
ELSRAPRGASAPPQDPASSARNKRSHSGEPAPHIRAESHDMLMMMTYSMVPIRVMVDLCNSTKGICLTGP     71 - 140
SGPPGPPGAGGLPGHNGLDGQPGPQGPKGEKGANGKRGKMGIPGAAGNPGERGEKGDHGELGLQGNEGPP    141 - 210
GQKGEKGDKGDVSNDVLLAGAKGDQGPPGPPGPPGPPGPPGPPGSRRAKGPRQPSMFNGQCPGETCAIPN    211 - 280
DDTLVGKADEKASEHHSPQAESMITSIGNPVQVLKVTETFGTWIRESANKSDDRIWVTEHFSGIMVKEFK    281 - 350
DQPSLLNGSYTFIHLPYYFHGCGHVVYNNSLYYHKGGSNTLVRFEFGQETSQTLKLENALYFDRKYLFAN    351 - 420
SKTYFNLAVDEKGLWIIYASSVDGSSILVAQLDERTFSVVQHVNTTYPKSKAGNAFIARGILYVTDTKDM    421 - 490
RVTFAFDLLGGKQINANFDLRTSQSVLAMLAYNMRDQHLYSWEDGHLMLYPVQFLSTTLNQ             491 - 551
//

Text Mined References (15)

PMID Year Title