Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.10
PubTator Score 0.14

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (9)

Disease log2 FC p
adult high grade glioma -1.300 4.0e-03
astrocytic glioma -1.100 5.0e-02
atypical teratoid / rhabdoid tumor -1.800 3.7e-07
glioblastoma -1.700 2.1e-05
medulloblastoma -1.200 2.6e-03
medulloblastoma, large-cell -1.800 1.3e-04
osteosarcoma 1.087 5.9e-03
ovarian cancer -1.900 1.7e-08
pituitary cancer 1.200 1.3e-04

Synonym

Accession Q6ZMI0 B7ZKY5 B7ZKY7 E1B6W7 Q2TA78 Q6ZMI6 Q8IW83 Q8J029 Q96ES8
Symbols KLRAQ1
CCDC128

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GO Function (1)

 GO Component (1)

 Compartment GO Term (1)

AA Sequence

MASAELQGKYQKLAQEYSKLRAQNQVLKKGVVDEQANSAALKEQLKMKDQSLRKLQQEMDSLTFRNLQLA      1 - 70
KRVELLQDELALSEPRGKKNKKSGESSSQLSQEQKSVFDEDLQKKIEENERLHIQFFEADEQHKHVEAEL     71 - 140
RSRLATLETEAAQHQAVVDGLTRKYMETIEKLQNDKAKLEVKSQTLEKEAKECRLRTEECQLQLKTLHED    141 - 210
LSGRLEESLSIINEKVPFNDTKYSQYNALNVPLHNRRHQLKMRDIAGQALAFVQDLVTALLNFHTYTEQR    211 - 280
IQIFPVDSAIDTISPLNQKFSQYLHENASYVRPLEEGMLHLFESITEDTVTVLETTVKLKTFSEHLTSYI    281 - 350
CFLRKILPYQLKSLEEECESSLCTSALRARNLELSQDMKKMTAVFEKLQTYIALLALPSTEPDGLLRTNY    351 - 420
SSVLTNVGAALHGFHDVMKDISKHYSQKAAIEHELPTATQKLITTNDCILSSVVALTNGAGKIASFFSNN    421 - 490
LDYFIASLSYGPKAASGFISPLSAECMLQYKKKAAAYMKSLRKPLLESVPYEEALANRRILLSSTESREG    491 - 560
LAQQVQQSLEKISKLEQEKEHWMLEAQLAKIKLEKENQRIADKLKNTGSAQLVGLAQENAAVSNTAGQDE    561 - 630
ATAKAVLEPIQSTSLIGTLTRTSDSEVPDVESREDLIKNHYMARIVELTSQLQLADSKSVHFYAECRALS    631 - 700
KRLALAEKSKEALTEEMKLASQNISRLQDELTTTKRSYEDQLSMMSDHLCSMNETLSKQREEIDTLKMSS    701 - 770
KGNSKKNKSR                                                                771 - 780
//

Text Mined References (7)

PMID Year Title