Property Summary

NCBI Gene PubMed Count 11
Grant Count 6
R01 Count 6
Funding $823,158.5
PubMed Score 12.43
PubTator Score 6.16

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q6ZMH5 B2R808 Q8N6Y3
Symbols ZIP5
MYP24
LZT-Hs7

Gene

PANTHER Protein Class (1)

Gene RIF (3)

PMID Text
26133979 ZIP5 knockdown inhibited the proliferation, migration and invasion of ESCC and suppressed COX2, cyclin D1 and E-cadherin expression, which led to the inhibition of cell progression in esophageal squamous cell carcinoma .
25525168 mutation in LRPAP1 is associated with high myopia. Further studies are expected to evaluate the pathogenicity of the variants in CTSH, LEPREL1, ZNF644, SLC39A5, and SCO2.
15322118 Zip5 protein is a zinc transporter that localizes to the basolateral surface of polarized cells

AA Sequence

MMGSPVSHLLAGFCVWVVLGWVGGSVPNLGPAEQEQNHYLAQLFGLYGENGTLTAGGLARLLHSLGLGRV      1 - 70
QGLRLGQHGPLTGRAASPAADNSTHRPQNPELSVDVWAGMPLGPSGWGDLEESKAPHLPRGPAPSGLDLL     71 - 140
HRLLLLDHSLADHLNEDCLNGSQLLVNFGLSPAAPLTPRQFALLCPALLYQIDSRVCIGAPAPAPPGDLL    141 - 210
SALLQSALAVLLLSLPSPLSLLLLRLLGPRLLRPLLGFLGALAVGTLCGDALLHLLPHAQEGRHAGPGGL    211 - 280
PEKDLGPGLSVLGGLFLLFVLENMLGLLRHRGLRPRCCRRKRRNLETRNLDPENGSGMALQPLQAAPEPG    281 - 350
AQGQREKNSQHPPALAPPGHQGHSHGHQGGTDITWMVLLGDGLHNLTDGLAIGAAFSDGFSSGLSTTLAV    351 - 420
FCHELPHELGDFAMLLQSGLSFRRLLLLSLVSGALGLGGAVLGVGLSLGPVPLTPWVFGVTAGVFLYVAL    421 - 490
VDMLPALLRPPEPLPTPHVLLQGLGLLLGGGLMLAITLLEERLLPVTTEG                        491 - 540
//

Text Mined References (11)

PMID Year Title
26133979 2015 Knockdown of zinc transporter ZIP5 (SLC39A5) expression significantly inhibits human esophageal cancer progression.
25525168 2014 Detection of mutations in LRPAP1, CTSH, LEPREL1, ZNF644, SLC39A5, and SCO2 in 298 families with early-onset high myopia by exome sequencing.
24891338 2014 SLC39A5 mutations interfering with the BMP/TGF-? pathway in non-syndromic high myopia.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15322118 2004 The mammalian Zip5 protein is a zinc transporter that localizes to the basolateral surface of polarized cells.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12839489 2003 Structure-function analysis of LIV-1, the breast cancer-associated protein that belongs to a new subfamily of zinc transporters.
12659941 2003 The LZT proteins; the LIV-1 subfamily of zinc transporters.
More...