Property Summary

NCBI Gene PubMed Count 25
Grant Count 19
R01 Count 1
Funding $1,566,933.1
PubMed Score 28.47
PubTator Score 19.68

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (27)

Disease log2 FC p
Rheumatoid Arthritis 1.300 0.015
malignant mesothelioma -1.500 0.000
ependymoma -1.800 0.029
psoriasis -1.700 0.000
cutaneous lupus erythematosus -1.300 0.002
osteosarcoma 2.083 0.000
cystic fibrosis 1.140 0.000
glioblastoma -1.400 0.000
medulloblastoma, large-cell 1.900 0.002
tuberculosis 1.800 0.000
non-small cell lung cancer 2.150 0.000
intraductal papillary-mucinous adenoma (... 1.700 0.005
intraductal papillary-mucinous carcinoma... 1.900 0.006
intraductal papillary-mucinous neoplasm ... 2.200 0.003
lung cancer 2.400 0.000
pancreatic cancer 1.400 0.000
diabetes mellitus -1.200 0.002
Breast cancer 3.400 0.022
group 4 medulloblastoma 1.900 0.000
pilocytic astrocytoma -1.100 0.001
lung adenocarcinoma 1.433 0.000
lung carcinoma 1.600 0.000
breast carcinoma 1.900 0.000
ductal carcinoma in situ 2.100 0.001
invasive ductal carcinoma 2.900 0.000
ovarian cancer 1.400 0.001
pituitary cancer 2.000 0.000

Gene RIF (18)

PMID Text
26887952 These results suggest that the phosphorylation of ceramide synthases may be a key regulatory point in the control of the distribution and levels of sphingolipids of various acyl-chain lengths.
26783755 Identification of CerS6 and ceramide pathways as a novel Methotrexate target.
26650179 CERS6-dependent ceramide synthesis and maintenance of ceramide in the cellular membrane are essential for lamellipodia formation and metastasis.
26318294 stichoposide D inhibits growth of experimental leukemia by activating Fas/ceramide synthase 6/p38 kinase in lipid rafts
25839235 Taken together, these results suggest that increased expression of CerS6 can mediate transcriptional activation of acid ceramidase in a JNK-dependent manner that is independent of CerS6 activity.
25833068 Data indicate that ceramide synthase 6 (CerS6) expression is upregulated in leukocytes from multiple sclerosis (MS) patients.
25766330 On the basis of its pivotal role in regulating cell death upon COX dysfunction, CerS6 might potentially represent a novel target for therapeutic intervention in mitochondrial diseases caused by COX dysfunction.
25173988 Upregulation of CERS6 in an experimental autoimmune encephalomyelitis model is sex dependent.
24632610 CerS6 as a novel epithelial-mesenchymal transition-regulated gene that has a pivotal role in the regulation of cell migration.
23538298 Co-expression of CerS2 with CerS4/CerS6 reversed the inhibitory effect of long chain ceramides on cell proliferation and the induction of apoptosis. we detected no effect on cell proliferation.
More...

AA Sequence

MAGILAWFWNERFWLPHNVTWADLKNTEEATFPQAEDLYLAFPLAFCIFMVRLIFERFVAKPCAIALNIQ      1 - 70
ANGPQIAPPNAILEKVFTAITKHPDEKRLEGLSKQLDWDVRSIQRWFRQRRNQEKPSTLTRFCESMWRFS     71 - 140
FYLYVFTYGVRFLKKTPWLWNTRHCWYNYPYQPLTTDLHYYYILELSFYWSLMFSQFTDIKRKDFGIMFL    141 - 210
HHLVSIFLITFSYVNNMARVGTLVLCLHDSADALLEAAKMANYAKFQKMCDLLFVMFAVVFITTRLGIFP    211 - 280
LWVLNTTLFESWEIVGPYPSWWVFNLLLLLVQGLNCFWSYLIVKIACKAVSRGKVSKDDRSDIESSSDEE    281 - 350
DSEPPGKNPHTATTTNGTSGTNGYLLTGSCSMDD                                        351 - 384
//

Text Mined References (27)

PMID Year Title
26887952 2016 Enzyme Activities of the Ceramide Synthases CERS2-6 Are Regulated by Phosphorylation in the C-terminal Region.
26783755 2016 Ceramide Synthase 6 Is a Novel Target of Methotrexate Mediating Its Antiproliferative Effect in a p53-Dependent Manner.
26650179 2016 Targeting ceramide synthase 6-dependent metastasis-prone phenotype in lung cancer cells.
26318294 2015 By activating Fas/ceramide synthase 6/p38 kinase in lipid rafts, stichoposide D inhibits growth of leukemia xenografts.
25839235 2015 Expression of Ceramide Synthase 6 Transcriptionally Activates Acid Ceramidase in a c-Jun N-terminal Kinase (JNK)-dependent Manner.
25833068 2015 Exacerbation of experimental autoimmune encephalomyelitis in ceramide synthase 6 knockout mice is associated with enhanced activation/migration of neutrophils.
25766330 2015 Cytochrome c oxidase deficiency accelerates mitochondrial apoptosis by activating ceramide synthase 6.
25173988 2014 Regulation of ceramide synthase 6 in a spontaneous experimental autoimmune encephalomyelitis model is sex dependent.
24632610 2015 Downregulation of ceramide synthase-6 during epithelial-to-mesenchymal transition reduces plasma membrane fluidity and cancer cell motility.
23538298 2013 The equilibrium between long and very long chain ceramides is important for the fate of the cell and can be influenced by co-expression of CerS.
More...