Property Summary

NCBI Gene PubMed Count 27
PubMed Score 32.36
PubTator Score 19.68

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (27)

Disease log2 FC p
Astrocytoma, Pilocytic -1.100 9.0e-04
Breast cancer 3.200 4.3e-02
breast carcinoma 1.200 4.7e-20
cutaneous lupus erythematosus -1.300 2.4e-03
cystic fibrosis 1.046 4.7e-05
diabetes mellitus -1.200 1.6e-03
ductal carcinoma in situ 1.100 1.5e-02
ependymoma -1.800 2.9e-02
glioblastoma -1.400 3.4e-06
group 4 medulloblastoma 1.100 5.0e-03
intraductal papillary-mucinous adenoma (... 1.400 2.8e-03
intraductal papillary-mucinous carcinoma... 1.700 1.2e-03
intraductal papillary-mucinous neoplasm ... 1.900 3.7e-03
invasive ductal carcinoma 1.600 1.6e-02
lung adenocarcinoma 1.433 3.7e-08
lung cancer 2.400 1.0e-04
lung carcinoma 1.600 8.2e-25
malignant mesothelioma -1.500 3.2e-06
medulloblastoma, large-cell 1.900 2.2e-03
non-small cell lung cancer 1.282 2.0e-18
osteosarcoma 2.083 6.7e-05
ovarian cancer 1.100 3.2e-03
pancreatic cancer 1.400 1.1e-05
pituitary cancer 1.500 5.6e-09
psoriasis -1.700 4.1e-10
Rheumatoid arthritis 1.300 1.5e-02
tuberculosis 1.800 5.5e-09

Gene RIF (20)

AA Sequence

MAGILAWFWNERFWLPHNVTWADLKNTEEATFPQAEDLYLAFPLAFCIFMVRLIFERFVAKPCAIALNIQ      1 - 70
ANGPQIAPPNAILEKVFTAITKHPDEKRLEGLSKQLDWDVRSIQRWFRQRRNQEKPSTLTRFCESMWRFS     71 - 140
FYLYVFTYGVRFLKKTPWLWNTRHCWYNYPYQPLTTDLHYYYILELSFYWSLMFSQFTDIKRKDFGIMFL    141 - 210
HHLVSIFLITFSYVNNMARVGTLVLCLHDSADALLEAAKMANYAKFQKMCDLLFVMFAVVFITTRLGIFP    211 - 280
LWVLNTTLFESWEIVGPYPSWWVFNLLLLLVQGLNCFWSYLIVKIACKAVSRGKVSKDDRSDIESSSDEE    281 - 350
DSEPPGKNPHTATTTNGTSGTNGYLLTGSCSMDD                                        351 - 384
//

Text Mined References (29)

PMID Year Title