Property Summary

NCBI Gene PubMed Count 7
PubMed Score 4.16
PubTator Score 0.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
lung adenocarcinoma 2716 4.6e-12
Breast cancer 3578 2.0e-05
ovarian cancer 8520 1.4e-04
fibroadenoma 559 1.6e-03
interstitial cystitis 2312 4.3e-03

Expression

  Differential Expression (5)

Disease log2 FC p
Breast cancer 1.100 2.0e-05
fibroadenoma 1.200 1.6e-03
interstitial cystitis -1.200 4.3e-03
lung adenocarcinoma 2.500 4.6e-12
ovarian cancer -1.200 1.4e-04

 GO Process (1)

Gene RIF (1)

AA Sequence

MSNVSGILETAGVPLVSANWPQPSPPPAVPAGPQMDHMGNSSQGAPWLFLTSALARGVSGIFVWTALVLT      1 - 70
CHQIYLHLRSYTVPQEQRYIIRLLLIVPIYAFDSWLSLLLLGDHQYYVYFDSVRDCYEAFVIYSFLSLCF     71 - 140
QYLGGEGAIMAEIRGKPIKSSCLYGTCCLRGMTYSIGFLRFCKQATLQFCLVKPVMAVTTIILQAFGKYH    141 - 210
DGDFNVRSGYLYVTLIYNASVSLALYALFLFYFTTRELLRPFQPVLKFLTIKAVIFLSFWQGLLLAILER    211 - 280
CGVIPEVETSGGNKLGAGTLAAGYQNFIICVEMLFASVALRYAFPCQVYAEKKENSPAPPAPMQSISSGI    281 - 350
RETVSPQDIVQDAIHNFSPAYQHYTQQATHEAPRPGTHPSGGSGGSRKSRSLEKRMLIPSEDL           351 - 413
//

Text Mined References (9)

PMID Year Title