Property Summary

NCBI Gene PubMed Count 14
PubMed Score 6.75
PubTator Score 8.19

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
adrenocortical carcinoma -1.017 3.0e-03
Multiple myeloma 1.290 3.1e-03
ovarian cancer -1.200 6.7e-04
Waldenstrons macroglobulinemia 1.250 4.5e-03

Gene RIF (5)

AA Sequence

MFLAQRSLCSLSGRAKFLKTISSSKILGFSTSAKMSLKFTNAKRIEGLDSNVWIEFTKLAADPSVVNLGQ      1 - 70
GFPDISPPTYVKEELSKIAAIDSLNQYTRGFGHPSLVKALSYLYEKLYQKQIDSNKEILVTVGAYGSLFN     71 - 140
TIQALIDEGDEVILIVPFYDCYEPMVRMAGATPVFIPLRSKPVYGKRWSSSDWTLDPQELESKFNSKTKA    141 - 210
IILNTPHNPLGKVYNREELQVIADLCIKYDTLCISDEVYEWLVYSGNKHLKIATFPGMWERTITIGSAGK    211 - 280
TFSVTGWKLGWSIGPNHLIKHLQTVQQNTIYTCATPLQEALAQAFWIDIKRMDDPECYFNSLPKELEVKR    281 - 350
DRMVRLLESVGLKPIVPDGGYFIIADVSLLDPDLSDMKNNEPYDYKFVKWMTKHKKLSAIPVSAFCNSET    351 - 420
KSQFEKFVRFCFIKKDSTLDAAEEIIKAWSVQKS                                        421 - 454
//

Text Mined References (20)

PMID Year Title