Property Summary

NCBI Gene PubMed Count 12
PubMed Score 5.53
PubTator Score 8.19

Knowledge Summary


No data available


  Disease Sources (2)

Disease Target Count P-value
ovarian cancer 8492 6.67713908837737E-4
adrenocortical carcinoma 1427 0.00301358209515665
Multiple myeloma 1328 0.0031124717341139
Waldenstrons macroglobulinemia 765 0.00446893135400716
Disease Target Count Z-score Confidence
Chronic obstructive pulmonary disease 147 0.0 1.0


  Differential Expression (4)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.250 0.004
Multiple myeloma 1.290 0.003
adrenocortical carcinoma -1.017 0.003
ovarian cancer -1.200 0.001


Accession Q6YP21 B3KQ13 O95335 Q5JS27 Q5T9T7 Q5T9T8 Q6AI27 Q6ICW1 Q9BVY5
Symbols KAT3


PANTHER Protein Class (2)

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG
Platypus OMA EggNOG
Anole lizard OMA EggNOG
Xenopus OMA EggNOG
C. elegans OMA EggNOG
S.cerevisiae OMA EggNOG

Gene RIF (5)

25231977 human KAT III/CCBL2 possesses cysteine S-conjugate beta-lyase activity, as does mouse KAT II
21492941 The haplotype of KAT III gene CGCTCT may have effect on the function of this enzyme in formation of kynurenic acid in some patients with major depressive episodes.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19165527 Using shotgun mass spectrometry, it was found that this protein is differentially expressed in the dorsolateral prefrontal cortex from patients with schizophrenia.

AA Sequence

KSQFEKFVRFCFIKKDSTLDAAEEIIKAWSVQKS                                        421 - 454

Text Mined References (18)

PMID Year Title
25231977 2014 Kynurenine aminotransferase III and glutamine transaminase L are identical enzymes that have cysteine S-conjugate ?-lyase activity and can transaminate L-selenomethionine.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22001757 2011 Genome-wide association study identifies loci influencing concentrations of liver enzymes in plasma.
21492941 2011 The kynurenine pathway in major depression: haplotype analysis of three related functional candidate genes.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.