Property Summary

NCBI Gene PubMed Count 13
PubMed Score 4.38
PubTator Score 3.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
aldosterone-producing adenoma -1.239 3.7e-02
Down syndrome 1.200 6.6e-04
ductal carcinoma in situ -1.900 5.5e-04
ependymoma 1.100 7.4e-05
fibroadenoma -1.300 2.0e-02
group 3 medulloblastoma -2.000 8.8e-04
hereditary spastic paraplegia -1.352 1.0e-02
interstitial cystitis -1.500 1.1e-03
interstitial lung disease -1.100 7.7e-03
invasive ductal carcinoma -1.900 2.5e-02
lung adenocarcinoma -1.200 2.4e-11
lung cancer -2.000 2.1e-03
medulloblastoma, large-cell -1.100 3.1e-02
non-small cell lung cancer -1.333 9.5e-15
osteosarcoma -2.039 1.6e-06
ovarian cancer -2.100 8.2e-07
pancreatic ductal adenocarcinoma liver m... -2.238 1.0e-03
subependymal giant cell astrocytoma 1.512 2.4e-02
tuberculosis 1.700 3.0e-04
ulcerative colitis -1.400 8.7e-07

Gene RIF (4)

AA Sequence

MLPNTGRLAGCTVFITGASRGIGKAIALKAAKDGANIVIAAKTAQPHPKLLGTIYTAAEEIEAVGGKALP      1 - 70
CIVDVRDEQQISAAVEKAIKKFGGIDILVNNASAISLTNTLDTPTKRLDLMMNVNTRGTYLASKACIPYL     71 - 140
KKSKVAHILNISPPLNLNPVWFKQHCAYTIAKYGMSMYVLGMAEEFKGEIAVNALWPKTAIHTAAMDMLG    141 - 210
GPGIESQCRKVDIIADAAYSIFQKPKSFTGNFVIDENILKEEGIENFDVYAIKPGHPLQPDFFLDEYPEA    211 - 280
VSKKVESTGAVPEFKEEKLQLQPKPRSGAVEETFRIVKDSLSDDVVKATQAIYLFELSGEDGGTWFLDLK    281 - 350
SKGGNVGYGEPSDQADVVMSMTTDDFVKMFSGKLKPTMAFMSGKLKIKGNMALAIKLEKLMNQMNARL      351 - 418
//

Text Mined References (19)

PMID Year Title