Property Summary

NCBI Gene PubMed Count 2
PubMed Score 1.46

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
active Crohn's disease 1.042 3.3e-02
acute quadriplegic myopathy 1.805 1.5e-05
adult high grade glioma 1.100 1.1e-02
aldosterone-producing adenoma -1.021 2.7e-02
Amyotrophic lateral sclerosis 1.643 7.4e-08
atypical teratoid / rhabdoid tumor 1.900 1.5e-04
cystic fibrosis 1.068 3.1e-04
ductal carcinoma in situ -1.100 1.7e-02
ependymoma -1.100 4.4e-02
glioblastoma 1.200 3.0e-04
interstitial cystitis -1.100 5.4e-04
lung adenocarcinoma -1.300 8.8e-10
lung carcinoma -1.100 4.0e-11
medulloblastoma, large-cell 1.200 7.3e-05
non primary Sjogren syndrome sicca 1.100 2.6e-02
osteosarcoma 1.166 2.7e-02
ovarian cancer -2.100 1.5e-10
pancreatic ductal adenocarcinoma liver m... -2.205 1.3e-02
primitive neuroectodermal tumor 1.200 6.2e-03
ulcerative colitis 1.200 1.2e-05

AA Sequence

MRSPGGILLQALPRLLQHAALPGLAELPARWALPRGAGGDGPADRLPRGGGASAAAAAAAASGALLGAYL      1 - 70
ERHGPPEASELPEPGGALAGGPGSGGGGVVVGVAEVRNWRCCCLGSTCWCRSLVLVCVLAALCFASLALV     71 - 140
RRYLHHLLLWVESLDSLLGVLLFVVGFIVVSFPCGWGYIVLNVAAGYLYGFVLGMGLMMVGVLIGTFIAH    141 - 210
VVCKRLLTAWVAARIQSSEKLSAVIRVVEGGSGLKVVALARLTPIPFGLQNAVFSITDLSLPNYLMASSV    211 - 280
GLLPTQLLNSYLGTTLRTMEDVIAEQSVSGYFVFCLQIIISIGLMFYVVHRAQVELNAAIVACEMELKSS    281 - 350
LVKGNQPNTSGSSFYNKRTLTFSGGGINVV                                            351 - 380
//

Text Mined References (5)

PMID Year Title