Property Summary

NCBI Gene PubMed Count 2
PubMed Score 1.46

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q6YI46 B4DUC0 F5GXM4 Q2HIZ7 Q8N3G6
Symbols

Gene

AA Sequence

MRSPGGILLQALPRLLQHAALPGLAELPARWALPRGAGGDGPADRLPRGGGASAAAAAAAASGALLGAYL      1 - 70
ERHGPPEASELPEPGGALAGGPGSGGGGVVVGVAEVRNWRCCCLGSTCWCRSLVLVCVLAALCFASLALV     71 - 140
RRYLHHLLLWVESLDSLLGVLLFVVGFIVVSFPCGWGYIVLNVAAGYLYGFVLGMGLMMVGVLIGTFIAH    141 - 210
VVCKRLLTAWVAARIQSSEKLSAVIRVVEGGSGLKVVALARLTPIPFGLQNAVFSITDLSLPNYLMASSV    211 - 280
GLLPTQLLNSYLGTTLRTMEDVIAEQSVSGYFVFCLQIIISIGLMFYVVHRAQVELNAAIVACEMELKSS    281 - 350
LVKGNQPNTSGSSFYNKRTLTFSGGGINVV                                            351 - 380
//

Publication (5)

PMID Year Title
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16421571 2006 DNA sequence and analysis of human chromosome 8.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.