Property Summary

NCBI Gene PubMed Count 51
Grant Count 1
Funding $121,482.5
PubMed Score 72.11
PubTator Score 56.33

Knowledge Summary

Patent

No data available

Expression

Synonym

Gene

 Grant Application (1)

Gene RIF (39)

PMID Text
26707640 These findings indicate that CD109 is an exosomal protein and that the C-terminal region of CD109 is required for its presence in the exosome.
26621871 sCD109 can bind TGF-beta, inhibit TGF-beta binding to its receptors and decrease TGF-beta signalling and TGF-beta-induced cellular responses.
26249215 CD109 may be a potential pathology marker for gallbladder squamous cell/adenosquamous carcinomas.
26122747 In title.
26031650 CD109 overexpression was significantly associated with surgical stage, distant metastasis, and poor prognosis in myxofibrosarcoma.
25724945 Three glioblastoma cell lines, SK-MG-1, U251MG and MG178, were tested and CD109 overexpression attenuated TGF-beta1 signaling and enhanced EGF signaling in SK-MG-1, but not in U251MG or MG178.
25506915 The results suggest that circulating endothelial cells express CD109 and represent a rare population of circulating tumor endothelial cells, that play a potentially useful prognostic role in patients with glioblastoma.
25388101 CD109 is specifically expressed in endothelial cells of cutaneous cavernous haemangioma.
25275127 Both HIV-1 Nef and Vpu downregulate the cell surface expression of CD109
25275127 Both HIV-1 Nef and Vpu downregulate the cell surface expression of CD109
More...

AA Sequence

MQGPPLLTAAHLLCVCTAALAVAPGPRFLVTAPGIIRPGGNVTIGVELLEHCPSQVTVKAELLKTASNLT      1 - 70
VSVLEAEGVFEKGSFKTLTLPSLPLNSADEIYELRVTGRTQDEILFSNSTRLSFETKRISVFIQTDKALY     71 - 140
KPKQEVKFRIVTLFSDFKPYKTSLNILIKDPKSNLIQQWLSQQSDLGVISKTFQLSSHPILGDWSIQVQV    141 - 210
NDQTYYQSFQVSEYVLPKFEVTLQTPLYCSMNSKHLNGTITAKYTYGKPVKGDVTLTFLPLSFWGKKKNI    211 - 280
TKTFKINGSANFSFNDEEMKNVMDSSNGLSEYLDLSSPGPVEILTTVTESVTGISRNVSTNVFFKQHDYI    281 - 350
IEFFDYTTVLKPSLNFTATVKVTRADGNQLTLEERRNNVVITVTQRNYTEYWSGSNSGNQKMEAVQKINY    351 - 420
TVPQSGTFKIEFPILEDSSELQLKAYFLGSKSSMAVHSLFKSPSKTYIQLKTRDENIKVGSPFELVVSGN    421 - 490
KRLKELSYMVVSRGQLVAVGKQNSTMFSLTPENSWTPKACVIVYYIEDDGEIISDVLKIPVQLVFKNKIK    491 - 560
LYWSKVKAEPSEKVSLRISVTQPDSIVGIVAVDKSVNLMNASNDITMENVVHELELYNTGYYLGMFMNSF    561 - 630
AVFQECGLWVLTDANLTKDYIDGVYDNAEYAERFMEENEGHIVDIHDFSLGSSPHVRKHFPETWIWLDTN    631 - 700
MGYRIYQEFEVTVPDSITSWVATGFVISEDLGLGLTTTPVELQAFQPFFIFLNLPYSVIRGEEFALEITI    701 - 770
FNYLKDATEVKVIIEKSDKFDILMTSNEINATGHQQTLLVPSEDGATVLFPIRPTHLGEIPITVTALSPT    771 - 840
ASDAVTQMILVKAEGIEKSYSQSILLDLTDNRLQSTLKTLSFSFPPNTVTGSERVQITAIGDVLGPSING    841 - 910
LASLIRMPYGCGEQNMINFAPNIYILDYLTKKKQLTDNLKEKALSFMRQGYQRELLYQREDGSFSAFGNY    911 - 980
DPSGSTWLSAFVLRCFLEADPYIDIDQNVLHRTYTWLKGHQKSNGEFWDPGRVIHSELQGGNKSPVTLTA    981 - 1050
YIVTSLLGYRKYQPNIDVQESIHFLESEFSRGISDNYTLALITYALSSVGSPKAKEALNMLTWRAEQEGG   1051 - 1120
MQFWVSSESKLSDSWQPRSLDIEVAAYALLSHFLQFQTSEGIPIMRWLSRQRNSLGGFASTQDTTVALKA   1121 - 1190
LSEFAALMNTERTNIQVTVTGPSSPSPVKFLIDTHNRLLLQTAELAVVQPTAVNISANGFGFAICQLNVV   1191 - 1260
YNVKASGSSRRRRSIQNQEAFDLDVAVKENKDDLNHVDLNVCTSFSGPGRSGMALMEVNLLSGFMVPSEA   1261 - 1330
ISLSETVKKVEYDHGKLNLYLDSVNETQFCVNIPAVRNFKVSNTQDASVSIVDYYEPRRQAVRSYNSEVK   1331 - 1400
LSSCDLCSDVQGCRPCEDGASGSHHHSSVIFIFCFKLLYFMELWL                            1401 - 1445
//

Text Mined References (57)

PMID Year Title
26707640 2016 CD109 is a component of exosome secreted from cultured cells.
26621871 2016 Soluble CD109 binds TGF-? and antagonizes TGF-? signalling and responses.
26249215 2015 CD109 is a novel marker for squamous cell/adenosquamous carcinomas of the gallbladder.
26122747 2015 Elevated Expression of CD109 in Esophageal Squamous Cell Carcinoma.
26031650 2015 Prognostic impact of CD109 expression in myxofibrosarcoma.
25787250 2015 Neomorphic effects of recurrent somatic mutations in Yin Yang 1 in insulin-producing adenomas.
25724945 2015 CD109 attenuates TGF-?1 signaling and enhances EGF signaling in SK-MG-1 human glioblastoma cells.
25506915 2014 A subpopulation of circulating endothelial cells express CD109 and is enriched in the blood of cancer patients.
25388101 2015 CD109 is specifically expressed in endothelial cells of cutaneous cavernous haemangioma.
25271095 2014 CD109 expression is increased in cutaneous squamous cell carcinoma.
More...