Property Summary

NCBI Gene PubMed Count 57
PubMed Score 77.79
PubTator Score 56.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
adult high grade glioma 1.100 3.2e-03
Astrocytoma, Pilocytic 1.400 3.2e-03
atypical teratoid / rhabdoid tumor 1.100 2.0e-02
autosomal dominant Emery-Dreifuss muscul... 1.072 1.8e-03
Breast cancer 1.100 4.1e-05
cystic fibrosis 1.258 2.3e-05
Duchenne muscular dystrophy 1.067 2.1e-07
ependymoma 2.100 1.3e-05
glioblastoma 1.300 1.6e-02
group 4 medulloblastoma -1.700 7.7e-04
interstitial cystitis 1.600 1.6e-04
intraductal papillary-mucinous adenoma (... -2.100 7.7e-03
invasive ductal carcinoma -1.600 2.3e-02
lung adenocarcinoma -1.400 1.3e-04
lung carcinoma -2.800 1.3e-23
medulloblastoma, large-cell -1.100 3.8e-03
non-small cell lung cancer 1.713 2.5e-11
osteosarcoma 1.660 1.5e-02
ovarian cancer -1.300 2.0e-02
pancreatic cancer 1.600 5.3e-04
primary pancreatic ductal adenocarcinoma 2.020 3.2e-04
tuberculosis -4.400 8.7e-10
ulcerative colitis 1.200 4.0e-03

 IMPC Phenotype (1)

Gene RIF (44)

AA Sequence

MQGPPLLTAAHLLCVCTAALAVAPGPRFLVTAPGIIRPGGNVTIGVELLEHCPSQVTVKAELLKTASNLT      1 - 70
VSVLEAEGVFEKGSFKTLTLPSLPLNSADEIYELRVTGRTQDEILFSNSTRLSFETKRISVFIQTDKALY     71 - 140
KPKQEVKFRIVTLFSDFKPYKTSLNILIKDPKSNLIQQWLSQQSDLGVISKTFQLSSHPILGDWSIQVQV    141 - 210
NDQTYYQSFQVSEYVLPKFEVTLQTPLYCSMNSKHLNGTITAKYTYGKPVKGDVTLTFLPLSFWGKKKNI    211 - 280
TKTFKINGSANFSFNDEEMKNVMDSSNGLSEYLDLSSPGPVEILTTVTESVTGISRNVSTNVFFKQHDYI    281 - 350
IEFFDYTTVLKPSLNFTATVKVTRADGNQLTLEERRNNVVITVTQRNYTEYWSGSNSGNQKMEAVQKINY    351 - 420
TVPQSGTFKIEFPILEDSSELQLKAYFLGSKSSMAVHSLFKSPSKTYIQLKTRDENIKVGSPFELVVSGN    421 - 490
KRLKELSYMVVSRGQLVAVGKQNSTMFSLTPENSWTPKACVIVYYIEDDGEIISDVLKIPVQLVFKNKIK    491 - 560
LYWSKVKAEPSEKVSLRISVTQPDSIVGIVAVDKSVNLMNASNDITMENVVHELELYNTGYYLGMFMNSF    561 - 630
AVFQECGLWVLTDANLTKDYIDGVYDNAEYAERFMEENEGHIVDIHDFSLGSSPHVRKHFPETWIWLDTN    631 - 700
MGYRIYQEFEVTVPDSITSWVATGFVISEDLGLGLTTTPVELQAFQPFFIFLNLPYSVIRGEEFALEITI    701 - 770
FNYLKDATEVKVIIEKSDKFDILMTSNEINATGHQQTLLVPSEDGATVLFPIRPTHLGEIPITVTALSPT    771 - 840
ASDAVTQMILVKAEGIEKSYSQSILLDLTDNRLQSTLKTLSFSFPPNTVTGSERVQITAIGDVLGPSING    841 - 910
LASLIRMPYGCGEQNMINFAPNIYILDYLTKKKQLTDNLKEKALSFMRQGYQRELLYQREDGSFSAFGNY    911 - 980
DPSGSTWLSAFVLRCFLEADPYIDIDQNVLHRTYTWLKGHQKSNGEFWDPGRVIHSELQGGNKSPVTLTA    981 - 1050
YIVTSLLGYRKYQPNIDVQESIHFLESEFSRGISDNYTLALITYALSSVGSPKAKEALNMLTWRAEQEGG   1051 - 1120
MQFWVSSESKLSDSWQPRSLDIEVAAYALLSHFLQFQTSEGIPIMRWLSRQRNSLGGFASTQDTTVALKA   1121 - 1190
LSEFAALMNTERTNIQVTVTGPSSPSPVKFLIDTHNRLLLQTAELAVVQPTAVNISANGFGFAICQLNVV   1191 - 1260
YNVKASGSSRRRRSIQNQEAFDLDVAVKENKDDLNHVDLNVCTSFSGPGRSGMALMEVNLLSGFMVPSEA   1261 - 1330
ISLSETVKKVEYDHGKLNLYLDSVNETQFCVNIPAVRNFKVSNTQDASVSIVDYYEPRRQAVRSYNSEVK   1331 - 1400
LSSCDLCSDVQGCRPCEDGASGSHHHSSVIFIFCFKLLYFMELWL                            1401 - 1445
//

Text Mined References (63)

PMID Year Title