Property Summary

NCBI Gene PubMed Count 51
PubMed Score 72.11
PubTator Score 56.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count P-value
lung carcinoma 2844 1.28877279941962E-23
non-small cell lung cancer 2798 2.49777703533983E-11
posterior fossa group A ependymoma 1511 1.05749316189163E-10
tuberculosis 1563 8.6976640626462E-10
Duchenne muscular dystrophy 602 2.10409893734999E-7
Breast cancer 3099 4.12054012113581E-5
lung adenocarcinoma 2714 1.27988095535562E-4
interstitial cystitis 2299 1.62927200350655E-4
cystic fibrosis 1670 2.4666019694159E-4
primary pancreatic ductal adenocarcinoma 1271 3.23455091608377E-4
ovarian cancer 8492 6.19714820305288E-4
group 4 medulloblastoma 1875 7.74860588276156E-4
pancreatic cancer 2300 8.11207005712142E-4
autosomal dominant Emery-Dreifuss muscular dystrophy 499 0.00178123189030376
pilocytic astrocytoma 3086 0.00294853593629966
medulloblastoma, large-cell 6234 0.00384635573114919
ulcerative colitis 2087 0.00402619879580733
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00765291558774777
osteosarcoma 7933 0.0153982612761139
glioblastoma 5572 0.0195905402518406
atypical teratoid / rhabdoid tumor 4369 0.0200420086950227
invasive ductal carcinoma 2950 0.0229905412832244
pediatric high grade glioma 2712 0.0243511436092152
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Thrombocytopenia 105 3.139 1.6

Expression

Synonym

Gene

  Ortholog (11)

 GWAS Trait (1)

Gene RIF (38)

PMID Text
26707640 These findings indicate that CD109 is an exosomal protein and that the C-terminal region of CD109 is required for its presence in the exosome.
26621871 sCD109 can bind TGF-beta, inhibit TGF-beta binding to its receptors and decrease TGF-beta signalling and TGF-beta-induced cellular responses.
26249215 CD109 may be a potential pathology marker for gallbladder squamous cell/adenosquamous carcinomas.
26122747 In title.
26031650 CD109 overexpression was significantly associated with surgical stage, distant metastasis, and poor prognosis in myxofibrosarcoma.
25724945 Three glioblastoma cell lines, SK-MG-1, U251MG and MG178, were tested and CD109 overexpression attenuated TGF-beta1 signaling and enhanced EGF signaling in SK-MG-1, but not in U251MG or MG178.
25506915 The results suggest that circulating endothelial cells express CD109 and represent a rare population of circulating tumor endothelial cells, that play a potentially useful prognostic role in patients with glioblastoma.
25388101 CD109 is specifically expressed in endothelial cells of cutaneous cavernous haemangioma.
25275127 Both HIV-1 Nef and Vpu downregulate the cell surface expression of CD109
25271095 expression increased in cutaneous squamous cell carcinoma
More...

AA Sequence

MQGPPLLTAAHLLCVCTAALAVAPGPRFLVTAPGIIRPGGNVTIGVELLEHCPSQVTVKAELLKTASNLT      1 - 70
VSVLEAEGVFEKGSFKTLTLPSLPLNSADEIYELRVTGRTQDEILFSNSTRLSFETKRISVFIQTDKALY     71 - 140
KPKQEVKFRIVTLFSDFKPYKTSLNILIKDPKSNLIQQWLSQQSDLGVISKTFQLSSHPILGDWSIQVQV    141 - 210
NDQTYYQSFQVSEYVLPKFEVTLQTPLYCSMNSKHLNGTITAKYTYGKPVKGDVTLTFLPLSFWGKKKNI    211 - 280
TKTFKINGSANFSFNDEEMKNVMDSSNGLSEYLDLSSPGPVEILTTVTESVTGISRNVSTNVFFKQHDYI    281 - 350
IEFFDYTTVLKPSLNFTATVKVTRADGNQLTLEERRNNVVITVTQRNYTEYWSGSNSGNQKMEAVQKINY    351 - 420
TVPQSGTFKIEFPILEDSSELQLKAYFLGSKSSMAVHSLFKSPSKTYIQLKTRDENIKVGSPFELVVSGN    421 - 490
KRLKELSYMVVSRGQLVAVGKQNSTMFSLTPENSWTPKACVIVYYIEDDGEIISDVLKIPVQLVFKNKIK    491 - 560
LYWSKVKAEPSEKVSLRISVTQPDSIVGIVAVDKSVNLMNASNDITMENVVHELELYNTGYYLGMFMNSF    561 - 630
AVFQECGLWVLTDANLTKDYIDGVYDNAEYAERFMEENEGHIVDIHDFSLGSSPHVRKHFPETWIWLDTN    631 - 700
MGYRIYQEFEVTVPDSITSWVATGFVISEDLGLGLTTTPVELQAFQPFFIFLNLPYSVIRGEEFALEITI    701 - 770
FNYLKDATEVKVIIEKSDKFDILMTSNEINATGHQQTLLVPSEDGATVLFPIRPTHLGEIPITVTALSPT    771 - 840
ASDAVTQMILVKAEGIEKSYSQSILLDLTDNRLQSTLKTLSFSFPPNTVTGSERVQITAIGDVLGPSING    841 - 910
LASLIRMPYGCGEQNMINFAPNIYILDYLTKKKQLTDNLKEKALSFMRQGYQRELLYQREDGSFSAFGNY    911 - 980
DPSGSTWLSAFVLRCFLEADPYIDIDQNVLHRTYTWLKGHQKSNGEFWDPGRVIHSELQGGNKSPVTLTA    981 - 1050
YIVTSLLGYRKYQPNIDVQESIHFLESEFSRGISDNYTLALITYALSSVGSPKAKEALNMLTWRAEQEGG   1051 - 1120
MQFWVSSESKLSDSWQPRSLDIEVAAYALLSHFLQFQTSEGIPIMRWLSRQRNSLGGFASTQDTTVALKA   1121 - 1190
LSEFAALMNTERTNIQVTVTGPSSPSPVKFLIDTHNRLLLQTAELAVVQPTAVNISANGFGFAICQLNVV   1191 - 1260
YNVKASGSSRRRRSIQNQEAFDLDVAVKENKDDLNHVDLNVCTSFSGPGRSGMALMEVNLLSGFMVPSEA   1261 - 1330
ISLSETVKKVEYDHGKLNLYLDSVNETQFCVNIPAVRNFKVSNTQDASVSIVDYYEPRRQAVRSYNSEVK   1331 - 1400
LSSCDLCSDVQGCRPCEDGASGSHHHSSVIFIFCFKLLYFMELWL                            1401 - 1445
//

Text Mined References (57)

PMID Year Title
26707640 2016 CD109 is a component of exosome secreted from cultured cells.
26621871 2016 Soluble CD109 binds TGF-? and antagonizes TGF-? signalling and responses.
26249215 2015 CD109 is a novel marker for squamous cell/adenosquamous carcinomas of the gallbladder.
26122747 2015 Elevated Expression of CD109 in Esophageal Squamous Cell Carcinoma.
26031650 2015 Prognostic impact of CD109 expression in myxofibrosarcoma.
25787250 2015 Neomorphic effects of recurrent somatic mutations in Yin Yang 1 in insulin-producing adenomas.
25724945 2015 CD109 attenuates TGF-?1 signaling and enhances EGF signaling in SK-MG-1 human glioblastoma cells.
25506915 2014 A subpopulation of circulating endothelial cells express CD109 and is enriched in the blood of cancer patients.
25388101 2015 CD109 is specifically expressed in endothelial cells of cutaneous cavernous haemangioma.
25271095 2014 CD109 expression is increased in cutaneous squamous cell carcinoma.
More...