Property Summary

NCBI Gene PubMed Count 7
PubMed Score 3.75
PubTator Score 0.38

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7950 3.3e-06

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma 1.761 3.3e-06

Gene RIF (1)

AA Sequence

MLDVEAQEPPKGKWSTPPFDPRFPSQNQIRNCYQNFLDYHRCLKTRTRRGKSTQPCEYYFRVYHSLCPIS      1 - 70
WVESWNEQIKNGIFAGKI                                                         71 - 88
//

Text Mined References (8)

PMID Year Title