Property Summary

NCBI Gene PubMed Count 7
PubMed Score 3.63
PubTator Score 0.38

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
osteosarcoma 7,933

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma 1.761 0.000

Synonym

Accession Q6YFQ2 Q7L1R4 Q96DL5
Symbols CT59
COXVIB2

Gene

PANTHER Protein Class (2)

Gene RIF (1)

PMID Text
18854154 Knockdown of cytochrome c oxidase subunit VIb polypeptide 2 (COX6B2) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1

AA Sequence

MLDVEAQEPPKGKWSTPPFDPRFPSQNQIRNCYQNFLDYHRCLKTRTRRGKSTQPCEYYFRVYHSLCPIS      1 - 70
WVESWNEQIKNGIFAGKI                                                         71 - 88
//

Publication (8)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15905330 2005 Identification of cancer/testis-antigen genes by massively parallel signature sequencing.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12874793 2003 Cytochrome c oxidase of mammals contains a testes-specific isoform of subunit VIb--the counterpart to testes-specific cytochrome c?
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
2172092 1990 Isolation of cDNAs encoding subunit VIb of cytochrome c oxidase and steady-state levels of coxVIb mRNA in different tissues.