Property Summary

NCBI Gene PubMed Count 7
PubMed Score 3.63
PubTator Score 0.38

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
osteosarcoma 7933 3.31614790319297E-6

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma 1.761 0.000

Synonym

Accession Q6YFQ2 Q7L1R4 Q96DL5
Symbols CT59
COXVIB2

Gene

PANTHER Protein Class (2)

  Ortholog (6)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG
S.cerevisiae OMA Inparanoid

Gene RIF (1)

PMID Text
18854154 Knockdown of cytochrome c oxidase subunit VIb polypeptide 2 (COX6B2) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1

AA Sequence

MLDVEAQEPPKGKWSTPPFDPRFPSQNQIRNCYQNFLDYHRCLKTRTRRGKSTQPCEYYFRVYHSLCPIS      1 - 70
WVESWNEQIKNGIFAGKI                                                         71 - 88
//

Text Mined References (8)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15905330 2005 Identification of cancer/testis-antigen genes by massively parallel signature sequencing.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12874793 2003 Cytochrome c oxidase of mammals contains a testes-specific isoform of subunit VIb--the counterpart to testes-specific cytochrome c?
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
2172092 1990 Isolation of cDNAs encoding subunit VIb of cytochrome c oxidase and steady-state levels of coxVIb mRNA in different tissues.