Property Summary

NCBI Gene PubMed Count 8
PubMed Score 30.57
PubTator Score 4.86

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (7)

Disease log2 FC p
active Crohn's disease 1.362 1.7e-02
interstitial cystitis 1.100 3.8e-04
intraductal papillary-mucinous carcinoma... 1.400 3.8e-02
lung carcinoma 1.200 1.1e-16
osteosarcoma -1.149 4.0e-02
Rheumatoid arthritis 1.200 1.2e-02
ulcerative colitis 1.100 2.5e-07

Gene RIF (3)

AA Sequence

MEAAATPAAAGAARREELDMDVMRPLINEQNFDGTSDEEHEQELLPVQKHYQLDDQEGISFVQTLMHLLK      1 - 70
GNIGTGLLGLPLAIKNAGIVLGPISLVFIGIISVHCMHILVRCSHFLCLRFKKSTLGYSDTVSFAMEVSP     71 - 140
WSCLQKQAAWGRSVVDFFLVITQLGFCSVYIVFLAENVKQVHEGFLESKVFISNSTNSSNPCERRSVDLR    141 - 210
IYMLCFLPFIILLVFIRELKNLFVLSFLANVSMAVSLVIIYQYVVRNMPDPHNLPIVAGWKKYPLFFGTA    211 - 280
VFAFEGIGVVLPLENQMKESKRFPQALNIGMGIVTTLYVTLATLGYMCFHDEIKGSITLNLPQDVWLYQS    281 - 350
VKILYSFGIFVTYSIQFYVPAEIIIPGITSKFHTKWKQICEFGIRSFLVSITCAGAILIPRLDIVISFVG    351 - 420
AVSSSTLALILPPLVEILTFSKEHYNIWMVLKNISIAFTGVVGFLLGTYITVEEIIYPTPKVVAGTPQSP    421 - 490
FLNLNSTCLTSGLK                                                            491 - 504
//

Text Mined References (10)

PMID Year Title