Property Summary

NCBI Gene PubMed Count 49
Grant Count 5
Funding $94,989.23
PubMed Score 36.49
PubTator Score 53.74

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
osteosarcoma -2.807 0.000
primitive neuroectodermal tumor 1.200 0.033
tuberculosis and treatment for 6 months -1.800 0.000
spina bifida -1.622 0.047
ovarian cancer -1.300 0.000
Breast cancer -1.100 0.000

Synonym

Accession Q6Y7W6 A6H8W4 B9EG55 E9PBB0 O75137 Q7Z2Z8 Q7Z3I2 Q96HU4 Q9NV82
Symbols GYF2
PERQ2
PERQ3
PARK11
TNRC15

Gene

Gene RIF (43)

PMID Text
26152800 Results suggest that the N56S and N457T of GIGYF2 are risk factors for Parkinson's disease in Caucasians, but not in Asians
26134514 required, this finding may shed light on the GIGYF2-associated mechanisms that lead to PD and suggests insulin dysregulation as a disease-specific mechanism for both PD and cognitive dysfunction.
25631074 Cellular biotinylated GRB10 interacting GYF protein 2 (GIGYF2, PERQ2) is incorporated into HIV-1 Gag virus-like particles
22751931 GIGYF2 and the zinc finger protein 598 (ZNF598) are identified as components of the 4EHP complex.
22503729 Our result indicated that SCNA, LRRK2, UCHL1, HtrA2 and GIGYF2 genes' mutations might not be a main reason for Chinese Autosomal dorminant Parkinson's disease
22115759 within the Chinese population, the c.297T>C p.Ala99Ala polymorphism of the GIGYF2 gene may be associated with an increased risk of developing Parkinson disease.
20816920 No clearly pathogenic mutations are identified in GIGYF2 and ATP13A2 in Brazilian patients with early-onset Parkinson's disease.
20816920 Observational study of gene-disease association. (HuGE Navigator)
20685231 Observational study of gene-disease association. (HuGE Navigator)
20641165 GIGYF2 is unlikely to play a major role in PD in Japanese patients, similar to other populations.
More...

AA Sequence

MAAETQTLNFGPEWLRALSSGGSITSPPLSPALPKYKLADYRYGREEMLALFLKDNKIPSDLLDKEFLPI      1 - 70
LQEEPLPPLALVPFTEEEQRNFSMSVNSAAVLRLTGRGGGGTVVGAPRGRSSSRGRGRGRGECGFYQRSF     71 - 140
DEVEGVFGRGGGREMHRSQSWEERGDRRFEKPGRKDVGRPNFEEGGPTSVGRKHEFIRSESENWRIFREE    141 - 210
QNGEDEDGGWRLAGSRRDGERWRPHSPDGPRSAGWREHMERRRRFEFDFRDRDDERGYRRVRSGSGSIDD    211 - 280
DRDSLPEWCLEDAEEEMGTFDSSGAFLSLKKVQKEPIPEEQEMDFRPVDEGEECSDSEGSHNEEAKEPDK    281 - 350
TNKKEGEKTDRVGVEASEETPQTSSSSARPGTPSDHQSQEASQFERKDEPKTEQTEKAEEETRMENSLPA    351 - 420
KVPSRGDEMVADVQQPLSQIPSDTASPLLILPPPVPNPSPTLRPVETPVVGAPGMGSVSTEPDDEEGLKH    421 - 490
LEQQAEKMVAYLQDSALDDERLASKLQEHRAKGVSIPLMHEAMQKWYYKDPQGEIQGPFNNQEMAEWFQA    491 - 560
GYFTMSLLVKRACDESFQPLGDIMKMWGRVPFSPGPAPPPHMGELDQERLTRQQELTALYQMQHLQYQQF    561 - 630
LIQQQYAQVLAQQQKAALSSQQQQQLALLLQQFQTLKMRISDQNIIPSVTRSVSVPDTGSIWELQPTASQ    631 - 700
PTVWEGGSVWDLPLDTTTPGPALEQLQQLEKAKAAKLEQERREAEMRAKREEEERKRQEELRRQQEEILR    701 - 770
RQQEEERKRREEEELARRKQEEALRRQREQEIALRRQREEEERQQQEEALRRLEERRREEEERRKQEELL    771 - 840
RKQEEEAAKWAREEEEAQRRLEENRLRMEEEAARLRHEEEERKRKELEVQRQKELMRQRQQQQEALRRLQ    841 - 910
QQQQQQQLAQMKLPSSSTWGQQSNTTACQSQATLSLAEIQKLEEERERQLREEQRRQQRELMKALQQQQQ    911 - 980
QQQQKLSGWGNVSKPSGTTKSLLEIQQEEARQMQKQQQQQQQHQQPNRARNNTHSNLHTSIGNSVWGSIN    981 - 1050
TGPPNQWASDLVSSIWSNADTKNSNMGFWDDAVKEVGPRNSTNKNKNNASLSKSVGVSNRQNKKVEEEEK   1051 - 1120
LLKLFQGVNKAQDGFTQWCEQMLHALNTANNLDVPTFVSFLKEVESPYEVHDYIRAYLGDTSEAKEFAKQ   1121 - 1190
FLERRAKQKANQQRQQQQLPQQQQQQPPQQPPQQPQQQDSVWGMNHSTLHSVFQTNQSNNQQSNFEAVQS   1191 - 1260
GKKKKKQKMVRADPSLLGFSVNASSERLNMGEIETLDDY                                  1261 - 1299
//

Text Mined References (65)

PMID Year Title
27157137 2016 Post-transcriptional gene silencing activity of human GIGYF2.
26152800 2015 The contribution of GIGYF2 to Parkinson's disease: a meta-analysis.
26134514 2015 GIGYF2 mutation in late-onset Parkinson's disease with cognitive impairment.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23974872 2013 Genome-wide association analysis identifies 13 new risk loci for schizophrenia.
23199482 2013 Ridaifen B, a tamoxifen derivative, directly binds to Grb10 interacting GYF protein 2.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
More...