Property Summary

NCBI Gene PubMed Count 17
Grant Count 190
R01 Count 121
Funding $23,443,346.75
PubMed Score 13.30
PubTator Score 45.61

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
breast carcinoma 1.100 0.002
ovarian cancer 1.300 0.000

Synonym

Accession Q6Y2X3 A5YM67 Q17RY2 Q66K17 Q96N59 Q96T63
Symbols DNAJ
HDJ3
LIP6
DRIP78

Gene

 GO Process (1)

Gene RIF (4)

PMID Text
26739057 This suggests that DNAJC14's folding activity normally modulates yellow fever virus NS3/4A/2K cleavage events to liberate appropriate levels of NS3 and NS4A and promote replication complex formation.
22915803 These findings support a novel model of DNAJC14 action that includes specific membrane targeting of both DNAJC14 and yellow fever virus replication proteins.
22815758 a molecular chaperone, DRiP78, that interacts with both CXCR4 and CCR5, but not the heterodimer formed by these receptors
21249176 DNAJC14 is required for yellow fever virus replication.

AA Sequence

MAQKHPGERGLYGAHHSGGASLRTLGPSVDPEIPSFSGLRDSAGTAPNGTRCLTEHSGPKHTQHPNPAHW      1 - 70
LDPSHGPPGGPGPPRDAEDPDQSETSSEEESGVDQELSKENETGNQKDGNSFLSIPSACNCQGTPGIPEG     71 - 140
PYSEGGNGSSSNFCHHCTSPALGEDELEEEYDDEESLKFPSDFSRVSSGKKPPSRRQRHRFPTKEDTREG    141 - 210
GRRDPRSPGRHRLGRKRSQADKRKGLGLWGAEELCQLGQAGFWWLIELLVLVGEYVETCGHLIYACRQLK    211 - 280
SSDLDLFRVWMGVWTGRLGGWAQVMFQFLSQGFYCGVGLFTRFLKLLGALLLLALALFLGFLQLGWRFLV    281 - 350
GLGDRLGWRDKATWLFSWLDSPALQRCLTLLRDSRPWQRLVRIVQWGWLELPWVKQNINRQGNAPVASGR    351 - 420
YCQPEEEVARLLTMAGVPEDELNPFHVLGVEATASDVELKKAYRQLAVMVHPDKNHHPRAEEAFKVLRAA    421 - 490
WDIVSNAEKRKEYEMKRMAENELSRSVNEFLSKLQDDLKEAMNTMMCSRCQGKHRRFEMDREPKSARYCA    491 - 560
ECNRLHPAEEGDFWAESSMLGLKITYFALMDGKVYDITEWAGCQRVGISPDTHRVPYHISFGSRIPGTRG    561 - 630
RQRATPDAPPADLQDFLSRIFQVPPGQMPNGNFFAAPQPAPGAAAASKPNSTVPKGEAKPKRRKKVRRPF    631 - 700
QR                                                                        701 - 702
//

Text Mined References (18)

PMID Year Title
26739057 2016 Chaperone-Assisted Protein Folding Is Critical for Yellow Fever Virus NS3/4A Cleavage and Replication.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22915803 2012 Flavivirus replication complex assembly revealed by DNAJC14 functional mapping.
22815758 2012 Dopamine receptor-interacting protein 78 acts as a molecular chaperone for CCR5 chemokine receptor signaling complex organization.
21249176 2011 Identification and characterization of the host protein DNAJC14 as a broadly active flavivirus replication modulator.
19946888 2010 Defining the membrane proteome of NK cells.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...