Property Summary

NCBI Gene PubMed Count 21
PubMed Score 45.32
PubTator Score 34.78

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (7)

Disease log2 FC p
ependymoma 1.700 7.4e-04
group 4 medulloblastoma -1.300 7.3e-03
interstitial cystitis -1.300 1.7e-02
lung carcinoma -1.200 2.2e-18
osteosarcoma -1.230 3.9e-02
ovarian cancer -1.300 1.9e-05
tuberculosis -1.500 2.4e-04

Gene RIF (13)

AA Sequence

MRPPACWWLLAPPALLALLTCSLAFGLASEDTKKEVKQSQDLEKSGISRKNDIDLKGIVFVIQSQSNSFH      1 - 70
AKRAEQLKKSILKQAADLTQELPSVLLLHQLAKQEGAWTILPLLPHFSVTYSRNSSWIFFCEEETRIQIP     71 - 140
KLLETLRRYDPSKEWFLGKALHDEEATIIHHYAFSENPTVFKYPDFAAGWALSIPLVNKLTKRLKSESLK    141 - 210
SDFTIDLKHEIALYIWDKGGGPPLTPVPEFCTNDVDFYCATTFHSFLPLCRKPVKKKDIFVAVKTCKKFH    211 - 280
GDRIPIVKQTWESQASLIEYYSDYTENSIPTVDLGIPNTDRGHCGKTFAILERFLNRSQDKTAWLVIVDD    281 - 350
DTLISISRLQHLLSCYDSGEPVFLGERYGYGLGTGGYSYITGGGGMVFSREAVRRLLASKCRCYSNDAPD    351 - 420
DMVLGMCFSGLGIPVTHSPLFHQARPVDYPKDYLSHQVPISFHKHWNIDPVKVYFTWLAPSDEDKARQET    421 - 490
QKGFREEL                                                                  491 - 498
//

Text Mined References (20)

PMID Year Title