Property Summary

NCBI Gene PubMed Count 10
PubMed Score 1.41
PubTator Score 1.75

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Gene RIF (4)

AA Sequence

MAAVAATAAAKGNGGGGGRAGAGDASGTRKKKGPGPLATAYLVIYNVVMTAGWLVIAVGLVRAYLAKGSY      1 - 70
HSLYYSIEKPLKFFQTGALLEILHCAIGIVPSSVVLTSFQVMSRVFLIWAVTHSVKEVQSEDSVLLFVIA     71 - 140
WTITEIIRYSFYTFSLLNHLPYLIKWARYTLFIVLYPMGVSGELLTIYAALPFVRQAGLYSISLPNKYNF    141 - 210
SFDYYAFLILIMISYIPIFPQLYFHMIHQRRKILSHTEEHKKFE                              211 - 254
//

Text Mined References (18)

PMID Year Title