Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.96
PubTator Score 1.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
osteosarcoma 7933 5.01249111637834E-9
medulloblastoma, large-cell 6234 2.18075089489008E-7
acute quadriplegic myopathy 1157 8.48666319715235E-7
adult high grade glioma 2148 8.32893788378877E-5
atypical teratoid / rhabdoid tumor 4369 3.18483428684724E-4
medulloblastoma 1524 4.48736963031972E-4
autosomal dominant Emery-Dreifuss muscular dystrophy 499 0.00123024807055671
ovarian cancer 8492 0.00137976840162817
ductal carcinoma in situ 1745 0.012489200643878
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0129208907919932
Multiple myeloma 1328 0.0200486705906321
Breast cancer 3099 0.0260219833290876
dermatomyositis 967 0.0287339689947068
subependymal giant cell astrocytoma 2287 0.036066121085123

Expression

Synonym

Accession Q6Y1H2
Symbols PTPLB

Gene

  Ortholog (4)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Cow OMA EggNOG

Gene RIF (3)

PMID Text
20677014 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
15024066 Data describe a novel human member of the protein tyrosine phosphatase-like B (PTPLB) family, an integral protein of the endoplasmic reticulum membrane, as a BAP31-interacting protein.

AA Sequence

MAAVAATAAAKGNGGGGGRAGAGDASGTRKKKGPGPLATAYLVIYNVVMTAGWLVIAVGLVRAYLAKGSY      1 - 70
HSLYYSIEKPLKFFQTGALLEILHCAIGIVPSSVVLTSFQVMSRVFLIWAVTHSVKEVQSEDSVLLFVIA     71 - 140
WTITEIIRYSFYTFSLLNHLPYLIKWARYTLFIVLYPMGVSGELLTIYAALPFVRQAGLYSISLPNKYNF    141 - 210
SFDYYAFLILIMISYIPIFPQLYFHMIHQRRKILSHTEEHKKFE                              211 - 254
//

Text Mined References (16)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21269460 2011 Initial characterization of the human central proteome.
20677014 2010 An approach based on a genome-wide association study reveals candidate loci for narcolepsy.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18554506 2008 Characterization of four mammalian 3-hydroxyacyl-CoA dehydratases involved in very long-chain fatty acid synthesis.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
More...