Property Summary

NCBI Gene PubMed Count 4
PubMed Score 6.11
PubTator Score 4.42

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6685 2.5e-07
Disease Target Count Z-score Confidence
Arrhythmogenic right ventricular cardiomyopathy 27 3.147 1.6

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.600 2.5e-07

Gene RIF (1)

PMID Text
14756426 This cDNA clone is 3287 bp and contains an open reading frame from 299 to 1870 encoding a putative protein of 523 amino acids. It shares 94.6 and 94.8% homology to rat Syt 10 and mouse Syt 10 at protein level, respectively.

AA Sequence

MSFHKEDGVNSLCQKALHIVTELCFAGQVEWEKCSGIFPRDRGSQGGSSTDISVSLLAVVVSFCGLALLV      1 - 70
VSLFVFWKLCWPCWKSKPVTSNITTLPQSISSAPTEVFETEEKKEIKENEKPAVKAIEPAIKISHTSPDI     71 - 140
PAEVQTALKEHLIKHARVQRQITEPTSSTRHSSFRRHLPRQMQVSSVDFSMGTEPVLQRGETTTSIGRIK    141 - 210
PELYKQKSVDSEGNQNEDVKICGKLNFTLQYDYENELLVVKIIKALDLPAKDFTGTSDPYVKMYLLPDRK    211 - 280
KKFQTRVHRKTLNPLFDETFQFPVAYDQLSNRKLHFSVYDFDRFSRHDMIGEVILDNLFEVSDLSREATV    281 - 350
WKDIHCATTESIDLGEIMFSLCYLPTAGRMTLTVIKCRNLKAMDITGSSDPYVKVSLMCEGRRLKKRKTT    351 - 420
TKKNTLNPVYNEAIIFDIPPENVDQVSLSIAVMDYDRVGHNEVIGVCRTGLDAEGLGRDHWNEMLAYHRK    421 - 490
PITHWHPLLELPGRATSFDSQGSCPSPKPPSTP                                         491 - 523
//

Text Mined References (4)

PMID Year Title
23583979 2013 Identification of heart rate-associated loci and their effects on cardiac conduction and rhythm disorders.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14756426 2003 Cloning and characterization of human synaptotagmin 10 gene.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.