Property Summary

NCBI Gene PubMed Count 3
Grant Count 9
R01 Count 3
Funding $996,183.75
PubMed Score 9.60
PubTator Score 1.29

Knowledge Summary

Patent

No data available

Expression

AA Sequence

MNSGREPRTPRTLLSIADILAPRMVPRAPSAPQLPESGPGPTSPLCALEELTSKTFRGLDARALQPSEGR      1 - 70
AGPDALGPGPFGRKRRKSRTAFTAQQVLELERRFVFQKYLAPSERDGLATRLGLANAQVVTWFQNRRAKL     71 - 140
KRDVEEMRADVASLRALSPEVLCSLALPEGAPDPGLCLGPAGPDSRPHLSDEEIQVDD                141 - 198
//

Text Mined References (5)

PMID Year Title
15498874 2004 Large-scale cDNA transfection screening for genes related to cancer development and progression.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11386758 2001 Characterization of the murine Lbx2 promoter, identification of the human homologue, and evaluation as a candidate for Alström syndrome.
9847074 1998 Toward a complete human genome sequence.