Property Summary

NCBI Gene PubMed Count 3
PubMed Score 9.66
PubTator Score 1.29

Knowledge Summary

Patent

No data available

Expression

AA Sequence

MNSGREPRTPRTLLSIADILAPRMVPRAPSAPQLPESGPGPTSPLCALEELTSKTFRGLDARALQPSEGR      1 - 70
AGPDALGPGPFGRKRRKSRTAFTAQQVLELERRFVFQKYLAPSERDGLATRLGLANAQVVTWFQNRRAKL     71 - 140
KRDVEEMRADVASLRALSPEVLCSLALPEGAPDPGLCLGPAGPDSRPHLSDEEIQVDD                141 - 198
//

Text Mined References (5)

PMID Year Title