Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00
PubTator Score 0.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6694 5.0e-33

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 3.400 5.0e-33

Synonym

Accession Q6XXX2
Symbols C21orf24
NCRNA00114

 Compartment GO Term (0)

AA Sequence

MQTTWQPGCSYPTSWLSSQESFSKMRTGWRGAIPLRWRNRARNREKPHSPRAVSSPATHSLPPSNPCRLT      1 - 70
PTLSSARPREGSCPSKCSCPGGNWSNTALSAELMWAEGRFSGGCLPVYMRQNINPGCQEQWEGEERSRWL     71 - 140
//

Text Mined References (2)

PMID Year Title