Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00
PubTator Score 0.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
psoriasis 6,685

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 3.400 0.000

Synonym

Accession Q6XXX2
Symbols C21orf24
NCRNA00114

Gene

 Compartment GO Term (0)

AA Sequence

MQTTWQPGCSYPTSWLSSQESFSKMRTGWRGAIPLRWRNRARNREKPHSPRAVSSPATHSLPPSNPCRLT      1 - 70
PTLSSARPREGSCPSKCSCPGGNWSNTALSAELMWAEGRFSGGCLPVYMRQNINPGCQEQWEGEERSRWL     71 - 140
//

Text Mined References (2)

PMID Year Title
14693372 2004 Detailed mapping of the ERG-ETS2 interval of human chromosome 21 and comparison with the region of conserved synteny on mouse chromosome 16.
10830953 2000 The DNA sequence of human chromosome 21.