Property Summary

NCBI Gene PubMed Count 14
Grant Count 2
R01 Count 2
Funding $893,575
PubMed Score 5.00
PubTator Score 5.48

Knowledge Summary

Patent (1,461)

Expression

  Differential Expression (9)

Disease log2 FC p
malignant mesothelioma -2.500 0.000
osteosarcoma 2.827 0.000
medulloblastoma -1.400 0.000
atypical teratoid / rhabdoid tumor -1.200 0.000
glioblastoma -1.100 0.000
medulloblastoma, large-cell -1.900 0.001
adult high grade glioma -1.600 0.000
aldosterone-producing adenoma -1.047 0.021
ovarian cancer -1.800 0.000

Synonym

Accession Q6XUX3 B7ZL64 O75060 Q17R94 Q5RKT0 Q6IN87 Q6P997 Q86Y03 Q9P1S5
Symbols RIP5
RIPK5
CAKUT1
DustyPK
HDCMD38P

Gene

 Grant Application (2)

Gene RIF (2)

PMID Text
23862974 We detected independent DSTYK mutations in 2.3% of patients with congenital abnormalities of the kidney or urinary tract, a finding that suggests that DSTYK is a major determinant of human urinary tract development, downstream of FGF signaling.
17123648 Confocal imaging of transiently expressed human Dusty-GFP fusion proteins showed a cytoplasmic distribution.

AA Sequence

MEGDGVPWGSEPVSGPGPGGGGMIRELCRGFGRYRRYLGRLRQNLRETQKFFRDIKCSHNHTCLSSLTGG      1 - 70
GGAERGPAGDVAETGLQAGQLSCISFPPKEEKYLQQIVDCLPCILILGQDCNVKCQLLNLLLGVQVLPTT     71 - 140
KLGSEESCKLRRLRFTYGTQTRVSLALPGQYELVHTLVAHQGNWETIPEEDLEVQENNEDAAHVLAELEV    141 - 210
TMHHALLQEVDVVVAPCQGLRPTVDVLGDLVNDFLPVITYALHKDELSERDEQELQEIRKYFSFPVFFFK    211 - 280
VPKLGSEIIDSSTRRMESERSPLYRQLIDLGYLSSSHWNCGAPGQDTKAQSMLVEQSEKLRHLSTFSHQV    281 - 350
LQTRLVDAAKALNLVHCHCLDIFINQAFDMQRDLQITPKRLEYTRKKENELYESLMNIANRKQEEMKDMI    351 - 420
VETLNTMKEELLDDATNMEFKDVIVPENGEPVGTREIKCCIRQIQELIISRLNQAVANKLISSVDYLRES    421 - 490
FVGTLERCLQSLEKSQDVSVHITSNYLKQILNAAYHVEVTFHSGSSVTRMLWEQIKQIIQRITWVSPPAI    491 - 560
TLEWKRKVAQEAIESLSASKLAKSICSQFRTRLNSSHEAFAASLRQLEAGHSGRLEKTEDLWLRVRKDHA    561 - 630
PRLARLSLESCSLQDVLLHRKPKLGQELGRGQYGVVYLCDNWGGHFPCALKSVVPPDEKHWNDLALEFHY    631 - 700
MRSLPKHERLVDLHGSVIDYNYGGGSSIAVLLIMERLHRDLYTGLKAGLTLETRLQIALDVVEGIRFLHS    701 - 770
QGLVHRDIKLKNVLLDKQNRAKITDLGFCKPEAMMSGSIVGTPIHMAPELFTGKYDNSVDVYAFGILFWY    771 - 840
ICSGSVKLPEAFERCASKDHLWNNVRRGARPERLPVFDEECWQLMEACWDGDPLKRPLLGIVQPMLQGIM    841 - 910
NRLCKSNSEQPNRGLDDST                                                       911 - 929
//

Text Mined References (17)

PMID Year Title
24026423 2014 A genome- and phenome-wide association study to identify genetic variants influencing platelet count and volume and their pleiotropic effects.
23862974 2013 Mutations in DSTYK and dominant urinary tract malformations.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19369195 2009 Large-scale proteomics analysis of the human kinome.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17123648 Dusty protein kinases: primary structure, gene evolution, tissue specific expression and unique features of the catalytic domain.
16751776 2006 A germline-specific class of small RNAs binds mammalian Piwi proteins.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
More...