Property Summary

NCBI Gene PubMed Count 14
PubMed Score 5.00
PubTator Score 5.48

Knowledge Summary

Patent (1,461)

Expression

  Differential Expression (9)

Disease log2 FC p
malignant mesothelioma -2.500 2.9e-07
osteosarcoma 2.827 3.6e-08
medulloblastoma -1.400 1.6e-07
atypical teratoid / rhabdoid tumor -1.200 1.2e-04
glioblastoma -1.100 4.8e-04
medulloblastoma, large-cell -1.900 5.5e-04
adult high grade glioma -1.600 3.6e-06
aldosterone-producing adenoma -1.047 2.1e-02
ovarian cancer -1.800 1.1e-09

Gene RIF (2)

PMID Text
23862974 We detected independent DSTYK mutations in 2.3% of patients with congenital abnormalities of the kidney or urinary tract, a finding that suggests that DSTYK is a major determinant of human urinary tract development, downstream of FGF signaling.
17123648 Confocal imaging of transiently expressed human Dusty-GFP fusion proteins showed a cytoplasmic distribution.

AA Sequence

MEGDGVPWGSEPVSGPGPGGGGMIRELCRGFGRYRRYLGRLRQNLRETQKFFRDIKCSHNHTCLSSLTGG      1 - 70
GGAERGPAGDVAETGLQAGQLSCISFPPKEEKYLQQIVDCLPCILILGQDCNVKCQLLNLLLGVQVLPTT     71 - 140
KLGSEESCKLRRLRFTYGTQTRVSLALPGQYELVHTLVAHQGNWETIPEEDLEVQENNEDAAHVLAELEV    141 - 210
TMHHALLQEVDVVVAPCQGLRPTVDVLGDLVNDFLPVITYALHKDELSERDEQELQEIRKYFSFPVFFFK    211 - 280
VPKLGSEIIDSSTRRMESERSPLYRQLIDLGYLSSSHWNCGAPGQDTKAQSMLVEQSEKLRHLSTFSHQV    281 - 350
LQTRLVDAAKALNLVHCHCLDIFINQAFDMQRDLQITPKRLEYTRKKENELYESLMNIANRKQEEMKDMI    351 - 420
VETLNTMKEELLDDATNMEFKDVIVPENGEPVGTREIKCCIRQIQELIISRLNQAVANKLISSVDYLRES    421 - 490
FVGTLERCLQSLEKSQDVSVHITSNYLKQILNAAYHVEVTFHSGSSVTRMLWEQIKQIIQRITWVSPPAI    491 - 560
TLEWKRKVAQEAIESLSASKLAKSICSQFRTRLNSSHEAFAASLRQLEAGHSGRLEKTEDLWLRVRKDHA    561 - 630
PRLARLSLESCSLQDVLLHRKPKLGQELGRGQYGVVYLCDNWGGHFPCALKSVVPPDEKHWNDLALEFHY    631 - 700
MRSLPKHERLVDLHGSVIDYNYGGGSSIAVLLIMERLHRDLYTGLKAGLTLETRLQIALDVVEGIRFLHS    701 - 770
QGLVHRDIKLKNVLLDKQNRAKITDLGFCKPEAMMSGSIVGTPIHMAPELFTGKYDNSVDVYAFGILFWY    771 - 840
ICSGSVKLPEAFERCASKDHLWNNVRRGARPERLPVFDEECWQLMEACWDGDPLKRPLLGIVQPMLQGIM    841 - 910
NRLCKSNSEQPNRGLDDST                                                       911 - 929
//

Text Mined References (17)

PMID Year Title
24026423 2014 A genome- and phenome-wide association study to identify genetic variants influencing platelet count and volume and their pleiotropic effects.
23862974 2013 Mutations in DSTYK and dominant urinary tract malformations.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19369195 2009 Large-scale proteomics analysis of the human kinome.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17123648 Dusty protein kinases: primary structure, gene evolution, tissue specific expression and unique features of the catalytic domain.
16751776 2006 A germline-specific class of small RNAs binds mammalian Piwi proteins.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15178406 2004 RIP5 is a RIP-homologous inducer of cell death.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10737800 2000 Shotgun sequencing of the human transcriptome with ORF expressed sequence tags.
9455484 1997 Characterization of cDNA clones in size-fractionated cDNA libraries from human brain.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
7829101 1994 Isolation of novel and known genes from a human fetal cochlear cDNA library using subtractive hybridization and differential screening.