Property Summary

Ligand Count 2
NCBI Gene PubMed Count 15
PubMed Score 5.41
PubTator Score 5.48

Knowledge Summary

Patent (1,461)

TINX Plot

  Disease (7)

Expression

  Differential Expression (9)

Disease log2 FC p
adult high grade glioma -1.600 3.6e-06
aldosterone-producing adenoma -1.047 2.1e-02
atypical teratoid / rhabdoid tumor -1.200 1.2e-04
glioblastoma -1.100 4.8e-04
group 4 medulloblastoma -1.100 5.4e-05
malignant mesothelioma -1.600 1.3e-05
medulloblastoma, large-cell -1.800 3.8e-05
osteosarcoma 2.827 3.6e-08
ovarian cancer -1.700 1.3e-09

Gene RIF (3)

AA Sequence

MEGDGVPWGSEPVSGPGPGGGGMIRELCRGFGRYRRYLGRLRQNLRETQKFFRDIKCSHNHTCLSSLTGG      1 - 70
GGAERGPAGDVAETGLQAGQLSCISFPPKEEKYLQQIVDCLPCILILGQDCNVKCQLLNLLLGVQVLPTT     71 - 140
KLGSEESCKLRRLRFTYGTQTRVSLALPGQYELVHTLVAHQGNWETIPEEDLEVQENNEDAAHVLAELEV    141 - 210
TMHHALLQEVDVVVAPCQGLRPTVDVLGDLVNDFLPVITYALHKDELSERDEQELQEIRKYFSFPVFFFK    211 - 280
VPKLGSEIIDSSTRRMESERSPLYRQLIDLGYLSSSHWNCGAPGQDTKAQSMLVEQSEKLRHLSTFSHQV    281 - 350
LQTRLVDAAKALNLVHCHCLDIFINQAFDMQRDLQITPKRLEYTRKKENELYESLMNIANRKQEEMKDMI    351 - 420
VETLNTMKEELLDDATNMEFKDVIVPENGEPVGTREIKCCIRQIQELIISRLNQAVANKLISSVDYLRES    421 - 490
FVGTLERCLQSLEKSQDVSVHITSNYLKQILNAAYHVEVTFHSGSSVTRMLWEQIKQIIQRITWVSPPAI    491 - 560
TLEWKRKVAQEAIESLSASKLAKSICSQFRTRLNSSHEAFAASLRQLEAGHSGRLEKTEDLWLRVRKDHA    561 - 630
PRLARLSLESCSLQDVLLHRKPKLGQELGRGQYGVVYLCDNWGGHFPCALKSVVPPDEKHWNDLALEFHY    631 - 700
MRSLPKHERLVDLHGSVIDYNYGGGSSIAVLLIMERLHRDLYTGLKAGLTLETRLQIALDVVEGIRFLHS    701 - 770
QGLVHRDIKLKNVLLDKQNRAKITDLGFCKPEAMMSGSIVGTPIHMAPELFTGKYDNSVDVYAFGILFWY    771 - 840
ICSGSVKLPEAFERCASKDHLWNNVRRGARPERLPVFDEECWQLMEACWDGDPLKRPLLGIVQPMLQGIM    841 - 910
NRLCKSNSEQPNRGLDDST                                                       911 - 929
//

Text Mined References (18)

PMID Year Title