Property Summary

NCBI Gene PubMed Count 17
PubMed Score 107.23
PubTator Score 95.36

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
ependymoma -1.900 4.1e-02
oligodendroglioma -1.700 3.5e-02
medulloblastoma -1.800 4.6e-06
atypical teratoid / rhabdoid tumor -1.100 3.8e-02
glioblastoma -1.600 4.8e-03
medulloblastoma, large-cell -2.300 1.6e-04
adrenocortical carcinoma 2.454 9.7e-03
pancreatic ductal adenocarcinoma liver m... -2.226 4.4e-03
colon cancer -3.700 7.0e-03
active Crohn's disease -2.828 2.0e-02
adult high grade glioma -1.200 9.4e-03
pilocytic astrocytoma -1.300 2.0e-04
non primary Sjogren syndrome sicca -1.600 1.7e-02
ulcerative colitis -4.000 4.9e-08
ovarian cancer -1.600 8.0e-06
psoriasis -2.700 5.2e-36

Gene RIF (12)

PMID Text
26628504 allele was also associated with increased sway velocity (15%, P = .033; adjusted for age and sex) and reduced SLC30A10 expression
25778823 We describe early disease manifestations (including videos) in 5 previously unreported Indian children, carrying novel homozygous SLC30A10 mutation
25319704 SLC30A10 is a cell surface-localized manganese efflux transporter that reduces manganese levels and protects against manganese toxicity.
24576911 These results suggest that both the up-regulation of ZIP14 and the down-regulation of ZnT10 by IL-6 might have enhanced the accumulation of manganese in SH-SY5Y cells.
23741496 ZnT10 is significantly decreased in the frontal cortex in Alzheimer's disease.
23369405 a case of inherited manganism caused by SLC30A10 mutation is presented
23357421 This review will address Mn transport proteins, the newly discovered SLC30A10 mutations and their implications to Parkinsonism and Mn regulation.
22706290 The study demonstrates down-regulation by Zn of ZnT10 mRNA levels in cultured intestinal and neuroblastoma cell lines and demonstrate reduced transcription from the ZnT10 promoter at an elevated extracellular Zn concentration.
22341972 This work has confirmed that SLC30A10 functions as a Mn transporter in humans that, when defective, causes Mn accumulation in liver and brain.
22341971 SLC30A10 mutations cause a treatable recessive disease with pleomorphic phenotype, and provide compelling evidence that SLC30A10 plays a pivotal role in manganese transport.
19064571 Observational study of gene-disease association. (HuGE Navigator)
15154973 identified the full-length sequences of SLC30A10, extending the SLC30 family to ten members; used an expressed sequence tag (EST) data mining strategy to determine the pattern of ZnT genes expression in tissues

AA Sequence

MGRYSGKTCRLLFMLVLTVAFFVAELVSGYLGNSIALLSDSFNMLSDLISLCVGLSAGYIARRPTRGFSA      1 - 70
TYGYARAEVVGALSNAVFLTALCFTIFVEAVLRLARPERIDDPELVLIVGVLGLLVNVVGLLIFQDCAAW     71 - 140
FACCLRGRSRRLQQRQQLAEGCVPGAFGGPQGAEDPRRAADPTAPGSDSAVTLRGTSVERKREKGATVFA    141 - 210
NVAGDSFNTQNEPEDMMKKEKKSEALNIRGVLLHVMGDALGSVVVVITAIIFYVLPLKSEDPCNWQCYID    211 - 280
PSLTVLMVIIILSSAFPLIKETAAILLQMVPKGVNMEELMSKLSAVPGISSVHEVHIWELVSGKIIATLH    281 - 350
IKYPKDRGYQDASTKIREIFHHAGIHNVTIQFENVDLKEPLEQKDLLLLCNSPCISKGCAKQLCCPPGAL    351 - 420
PLAHVNGCAEHNGGPSLDTYGSDGLSRRDAREVAIEVSLDSCLSDHGQSLNKTQEDQCYVNRTHF         421 - 485
//

Text Mined References (19)

PMID Year Title
26628504 2016 Common Polymorphisms in the Solute Carrier SLC30A10 are Associated With Blood Manganese and Neurological Function.
25778823 2015 Manganese transport disorder: novel SLC30A10 mutations and early phenotypes.
25582195 2015 The zinc finger protein ZNF658 regulates the transcription of genes involved in zinc homeostasis and affects ribosome biogenesis through the zinc transcriptional regulatory element.
25319704 2014 SLC30A10 is a cell surface-localized manganese efflux transporter, and parkinsonism-causing mutations block its intracellular trafficking and efflux activity.
24576911 2014 Interleukin-6 enhances manganese accumulation in SH-SY5Y cells: implications of the up-regulation of ZIP14 and the down-regulation of ZnT10.
23754948 2013 Sex-stratified genome-wide association studies including 270,000 individuals show sexual dimorphism in genetic loci for anthropometric traits.
23741496 2013 Altered expression of ZnT10 in Alzheimer's disease brain.
23369405 2013 Inherited manganism.
23357421 2013 Manganese efflux in Parkinsonism: insights from newly characterized SLC30A10 mutations.
22706290 2012 Efflux function, tissue-specific expression and intracellular trafficking of the Zn transporter ZnT10 indicate roles in adult Zn homeostasis.
22341972 2012 Syndrome of hepatic cirrhosis, dystonia, polycythemia, and hypermanganesemia caused by mutations in SLC30A10, a manganese transporter in man.
22341971 2012 Mutations in SLC30A10 cause parkinsonism and dystonia with hypermanganesemia, polycythemia, and chronic liver disease.
19064571 2008 Polymorphisms in mitochondrial genes and prostate cancer risk.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15154973 2004 In silico identification and expression of SLC30 family genes: an expressed sequence tag data mining strategy for the characterization of zinc transporters' tissue expression.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.