Property Summary

NCBI Gene PubMed Count 17
Grant Count 40
R01 Count 23
Funding $5,645,952.58
PubMed Score 107.23
PubTator Score 95.36

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
ependymoma -1.900 0.041
oligodendroglioma -1.700 0.035
medulloblastoma -1.800 0.000
atypical teratoid / rhabdoid tumor -1.100 0.038
glioblastoma -1.600 0.005
medulloblastoma, large-cell -2.300 0.000
adrenocortical carcinoma 2.454 0.010
pancreatic ductal adenocarcinoma liver m... -2.226 0.004
colon cancer -3.700 0.007
active Crohn's disease -2.828 0.020
adult high grade glioma -1.200 0.009
pilocytic astrocytoma -1.300 0.000
non primary Sjogren syndrome sicca -1.600 0.017
ulcerative colitis -4.000 0.000
ovarian cancer -1.600 0.000
psoriasis -2.700 0.000

Gene RIF (12)

PMID Text
26628504 allele was also associated with increased sway velocity (15%, P = .033; adjusted for age and sex) and reduced SLC30A10 expression
25778823 We describe early disease manifestations (including videos) in 5 previously unreported Indian children, carrying novel homozygous SLC30A10 mutation
25319704 SLC30A10 is a cell surface-localized manganese efflux transporter that reduces manganese levels and protects against manganese toxicity.
24576911 These results suggest that both the up-regulation of ZIP14 and the down-regulation of ZnT10 by IL-6 might have enhanced the accumulation of manganese in SH-SY5Y cells.
23741496 ZnT10 is significantly decreased in the frontal cortex in Alzheimer's disease.
23369405 a case of inherited manganism caused by SLC30A10 mutation is presented
23357421 This review will address Mn transport proteins, the newly discovered SLC30A10 mutations and their implications to Parkinsonism and Mn regulation.
22706290 The study demonstrates down-regulation by Zn of ZnT10 mRNA levels in cultured intestinal and neuroblastoma cell lines and demonstrate reduced transcription from the ZnT10 promoter at an elevated extracellular Zn concentration.
22341972 This work has confirmed that SLC30A10 functions as a Mn transporter in humans that, when defective, causes Mn accumulation in liver and brain.
22341971 SLC30A10 mutations cause a treatable recessive disease with pleomorphic phenotype, and provide compelling evidence that SLC30A10 plays a pivotal role in manganese transport.
More...

AA Sequence

MGRYSGKTCRLLFMLVLTVAFFVAELVSGYLGNSIALLSDSFNMLSDLISLCVGLSAGYIARRPTRGFSA      1 - 70
TYGYARAEVVGALSNAVFLTALCFTIFVEAVLRLARPERIDDPELVLIVGVLGLLVNVVGLLIFQDCAAW     71 - 140
FACCLRGRSRRLQQRQQLAEGCVPGAFGGPQGAEDPRRAADPTAPGSDSAVTLRGTSVERKREKGATVFA    141 - 210
NVAGDSFNTQNEPEDMMKKEKKSEALNIRGVLLHVMGDALGSVVVVITAIIFYVLPLKSEDPCNWQCYID    211 - 280
PSLTVLMVIIILSSAFPLIKETAAILLQMVPKGVNMEELMSKLSAVPGISSVHEVHIWELVSGKIIATLH    281 - 350
IKYPKDRGYQDASTKIREIFHHAGIHNVTIQFENVDLKEPLEQKDLLLLCNSPCISKGCAKQLCCPPGAL    351 - 420
PLAHVNGCAEHNGGPSLDTYGSDGLSRRDAREVAIEVSLDSCLSDHGQSLNKTQEDQCYVNRTHF         421 - 485
//

Text Mined References (19)

PMID Year Title
26628504 2016 Common Polymorphisms in the Solute Carrier SLC30A10 are Associated With Blood Manganese and Neurological Function.
25778823 2015 Manganese transport disorder: novel SLC30A10 mutations and early phenotypes.
25582195 2015 The zinc finger protein ZNF658 regulates the transcription of genes involved in zinc homeostasis and affects ribosome biogenesis through the zinc transcriptional regulatory element.
25319704 2014 SLC30A10 is a cell surface-localized manganese efflux transporter, and parkinsonism-causing mutations block its intracellular trafficking and efflux activity.
24576911 2014 Interleukin-6 enhances manganese accumulation in SH-SY5Y cells: implications of the up-regulation of ZIP14 and the down-regulation of ZnT10.
23754948 2013 Sex-stratified genome-wide association studies including 270,000 individuals show sexual dimorphism in genetic loci for anthropometric traits.
23741496 2013 Altered expression of ZnT10 in Alzheimer's disease brain.
23369405 2013 Inherited manganism.
23357421 2013 Manganese efflux in Parkinsonism: insights from newly characterized SLC30A10 mutations.
22706290 2012 Efflux function, tissue-specific expression and intracellular trafficking of the Zn transporter ZnT10 indicate roles in adult Zn homeostasis.
More...