Property Summary

NCBI Gene PubMed Count 5
PubMed Score 797.50
PubTator Score 5.88

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Gene RIF (1)

AA Sequence

MRLSVCLLMVSLALCCYQAHALVCPAVASEITVFLFLSDAAVNLQVAKLNPPPEALAAKLEVKHCTDQIS      1 - 70
FKKRLSLKKSWWK                                                              71 - 83
//

Text Mined References (6)

PMID Year Title