Property Summary

NCBI Gene PubMed Count 5
Grant Count 222
R01 Count 108
Funding $58,117,873.94
PubMed Score 753.76
PubTator Score 5.88

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Epilepsy 346 3.393 1.7

Synonym

Accession Q6XE38 A1L4Q8
Symbols IIS

Gene

PANTHER Protein Class (1)

Gene RIF (1)

PMID Text
15034037 This interferon-gamma-inducible secretoglobin gene, SCGB1D4, is expressed in virtually all tissues, and the highest level of expression is detectable in lymph nodes, tonsil, cultured lymphoblasts, and the ovary.

AA Sequence

MRLSVCLLMVSLALCCYQAHALVCPAVASEITVFLFLSDAAVNLQVAKLNPPPEALAAKLEVKHCTDQIS      1 - 70
FKKRLSLKKSWWK                                                              71 - 83
//

Publication (6)

PMID Year Title
22155607 2011 Update of the human secretoglobin (SCGB) gene superfamily and an example of 'evolutionary bloom' of androgen-binding protein genes within the mouse Scgb gene superfamily.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15340161 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites.
15034037 2004 IFN-gamma stimulates the expression of a novel secretoglobin that regulates chemotactic cell migration and invasion.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.