Property Summary

NCBI Gene PubMed Count 18
PubMed Score 10.62
PubTator Score 85.45

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
breast carcinoma 1614 6.76758590861107E-42
non-small cell lung cancer 2798 2.97772996487337E-23
lung carcinoma 2844 1.95541513475834E-20
Breast cancer 3099 1.88922863654741E-19
juvenile dermatomyositis 1189 2.93121516578878E-10
ovarian cancer 8492 6.18363626521462E-10
lung adenocarcinoma 2714 1.16729689625235E-8
Pick disease 1893 5.95549991777898E-7
acute quadriplegic myopathy 1157 6.03114029460086E-7
psoriasis 6685 9.80085553013558E-7
Amyotrophic Lateral Sclerosis 432 2.81234481827503E-5
atypical teratoid / rhabdoid tumor 4369 4.52410649091343E-5
invasive ductal carcinoma 2950 5.15151815657225E-5
ductal carcinoma in situ 1745 5.34016838790955E-5
medulloblastoma, large-cell 6234 1.33381844901887E-4
osteosarcoma 7933 1.46399461757363E-4
adrenocortical carcinoma 1427 3.19766832803788E-4
primary pancreatic ductal adenocarcinoma 1271 4.33630145258846E-4
group 4 medulloblastoma 1875 4.96448258405875E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00124344049803999
pancreatic cancer 2300 0.0016043634545234
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00200052170919193
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00285594640085316
colon cancer 1475 0.00292037928893097
Atopic dermatitis 944 0.00434006498872718
autosomal dominant Emery-Dreifuss muscular dystrophy 499 0.00791678109425508
posterior fossa group B ependymoma 1530 0.0138522941803793
aldosterone-producing adenoma 664 0.014221261678965
spina bifida 1064 0.0159258300253534
mucosa-associated lymphoid tissue lymphoma 480 0.0233097188883697
fibroadenoma 557 0.0290659392154348
primitive neuroectodermal tumor 3031 0.0397827512717177
Disease Target Count Z-score Confidence
Nasopharynx carcinoma 19 3.033 1.5

Expression

Synonym

Gene

  Ortholog (6)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid

Gene RIF (7)

PMID Text
25588924 RBMS3 is a novel tumor suppressor gene in lung squamous cell carcinoma
23045156 one interacting gene pair (RBMS3 versus ZNF516) which, even after Bonferroni correction for multiple testing, showed consistently significant effects on hip bone mineral density.
22957092 RBMS3 at 3p24 inhibits nasopharyngeal carcinoma development via inhibiting cell proliferation, angiogenesis, and inducing apoptosis
22267851 genetic susceptibility plays a role in the pathophysiology of Bisphosphonate-related osteonecrosis of the jaw (BRONJ), with RBMS3 having a significant effect in the risk.
21844183 a tumor suppression function for the human RBMS3 gene in esophageal squamous cell carcinoma, acting through c-Myc downregulation, with genetic loss of this gene contributing to poor outcomes in disease
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
17586524 These results suggest that RBMS3, by binding Prx1 mRNA in a sequence-specific manner, controls Prx1 expression and indirectly collagen synthesis.

AA Sequence

MGKRLDQPQMYPQYTYYYPHYLQTKQSYAPAPHPMAPPSPSTNSSSNNSSNNSSGEQLSKTNLYIRGLPP      1 - 70
GTTDQDLIKLCQPYGKIVSTKAILDKNTNQCKGYGFVDFDSPAAAQKAVASLKANGVQAQMAKQQEQDPT     71 - 140
NLYISNLPISMDEQELENMLKPFGHVISTRILRDANGVSRGVGFARMESTEKCEVVIQHFNGKYLKTPPG    141 - 210
IPAPSEPLLCKFADGGQKKRQNQSKYTQNGRPWPREGEAGMALTYDPTAAIQNGFYSSPYSIATNRMIPQ    211 - 280
TSITPFIAASPVSTYQVQSTSWMPHPPYVMQPTGAVITPTMDHPMSMQPANMMGPLTQQMNHLSLGTTGT    281 - 350
IQSQDRIMILHQLLCQYMTAAAPMQGTYIPQYTPVPPTAVSIEGVVADTSPQTVAPSSQDTSGQQQQIAV    351 - 420
DTSNEHAPAYSYQQSKP                                                         421 - 437
//

Text Mined References (19)

PMID Year Title
25588924 2015 RBMS3 is a tumor suppressor gene that acts as a favorable prognostic marker in lung squamous cell carcinoma.
24785509 2014 A genome wide association study (GWAS) providing evidence of an association between common genetic variants and late radiotherapy toxicity.
23259602 2012 Genome-wide association scan of dental caries in the permanent dentition.
23045156 2013 Gene-gene interaction between RBMS3 and ZNF516 influences bone mineral density.
22957092 2012 RBMS3 at 3p24 inhibits nasopharyngeal carcinoma development via inhibiting cell proliferation, angiogenesis, and inducing apoptosis.
22747683 2012 Genetic variants associated with breast size also influence breast cancer risk.
22267851 2012 Genomewide pharmacogenetics of bisphosphonate-induced osteonecrosis of the jaw: the role of RBMS3.
21844183 2011 Downregulation of RBMS3 is associated with poor prognosis in esophageal squamous cell carcinoma.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19654303 2009 Deciphering the impact of common genetic variation on lung cancer risk: a genome-wide association study.
More...