Property Summary

NCBI Gene PubMed Count 8
PubMed Score 1.69
PubTator Score 2.77

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
diabetes mellitus 1,663

Expression

  Differential Expression (1)

Disease log2 FC p
diabetes mellitus 1.100 0.001

Gene RIF (3)

PMID Text
22549224 intramitochondrial arachidonic acid and acyl-CoA synthetase 4 in angiotensin II-regulated aldosterone synthesis have roles in NCI-H295R adrenocortical cell line
19166906 In neuron reduced levels of ACSL4 led to a significant reduction in dendritic spine density and an alteration in spine/filopodia distribution.
15475265 HASH4 is involved in skin development.

AA Sequence

METRKPAERLALPYSLRTAPLGVPGTLPGLPRRDPLRVALRLDAACWEWARSGCARGWQYLPVPLDSAFE      1 - 70
PAFLRKRNERERQRVRCVNEGYARLRDHLPRELADKRLSKVETLRAAIDYIKHLQELLERQAWGLEGAAG     71 - 140
AVPQRRAECNSDGESKASSAPSPSSEPEEGGS                                          141 - 172
//

Text Mined References (10)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24927181 2014 Genome-wide association study identifies three novel susceptibility loci for severe Acne vulgaris.
22549224 2012 Role of intramitochondrial arachidonic acid and acyl-CoA synthetase 4 in angiotensin II-regulated aldosterone synthesis in NCI-H295R adrenocortical cell line.
19166906 2009 The XLMR gene ACSL4 plays a role in dendritic spine architecture.
16541075 2006 The finished DNA sequence of human chromosome 12.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15475265 2004 Hash4, a novel human achaete-scute homologue found in fetal skin.
14516699 2002 Exhaustive identification of human class II basic helix-loop-helix proteins by virtual library screening.
12617822 2002 Exhaustive identification of human class II basic helix-loop-helix proteins by virtual library screening.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.