Property Summary

NCBI Gene PubMed Count 8
PubMed Score 1.97
PubTator Score 2.77

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
diabetes mellitus 1728 1.2e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Expression

  Differential Expression (1)

Disease log2 FC p
diabetes mellitus 1.100 1.2e-03

Gene RIF (3)

AA Sequence

METRKPAERLALPYSLRTAPLGVPGTLPGLPRRDPLRVALRLDAACWEWARSGCARGWQYLPVPLDSAFE      1 - 70
PAFLRKRNERERQRVRCVNEGYARLRDHLPRELADKRLSKVETLRAAIDYIKHLQELLERQAWGLEGAAG     71 - 140
AVPQRRAECNSDGESKASSAPSPSSEPEEGGS                                          141 - 172
//

Text Mined References (10)

PMID Year Title