Knowledge Summary

Patent

No data available

Synonym

Accession Q6XCG6
Symbols

Gene

 Compartment GO Term (1)

AA Sequence

MWLSPWSTCPPHPLPSCLTACCSPAHQPVRGSAQPPASDLCTCVTCCSGPHPNYPPAHLLPTSSLPICPG      1 - 70
LICCLLTCLLVDCFSALLSACETRDLSPWKARRVLLR                                      71 - 107
//

Text Mined References (1)

PMID Year Title