Property Summary

NCBI Gene PubMed Count 6
PubMed Score 2.78
PubTator Score 2.67

Knowledge Summary

Patent

No data available

Expression

Gene RIF (3)

PMID Text
26617728 FBXW12 gene is deleted in approximately ten percent of the epithelial ovarian cancer cases studied; such deletions comprised either the FBXW12 promoter or the mRNA-encoding region.
26171402 FBXW12 functions as an E3 ligase constituent to ubiquitinate and degrade IL-22R and that therapeutic FBXW12 inhibition may enhance IL-22 signaling and bolster mucosal host defense and infection containment.
15040455 FBXO35 gene had a ubiquitously low expression pattern in most human adult tissues. FBXO35 gene was found located in chromosome 3p21.

AA Sequence

MEIRLPDLALKRIFSFLDLFGLLQVSQVNKHWNRIADSDYLWRSLSLQRWDCSNFTNQHLGTHTWKQFFL      1 - 70
HQRRKELRLALAQPHNFIYKVTKNIAFETELAYLSGNRLTVDEQEKSIICSVSPKQELCAWDVQEGTMIW     71 - 140
SSPVQEFHFSNLVTLPQMHLAITMDRKKTIKVWNCQDRDALAVLPMPQPCYCMEAYLTKDGPFLMVGDAA    141 - 210
GDIYTFTLPGLRDVSKVTAFQYGIVLLHCSPDKKWVFACGTYSRTLPQVFLTESLLRPSEGSVPLSTFLP    211 - 280
HKLCASACWTPKVKNRITLMSQSSTGKKTEFITFDLTTKKTGGQTVIQAYEIASFQVAAHLKCPIWMGAS    281 - 350
DGYMIVFTSGPYLLLFSITGFLLQRFEDHQAAINNFWVDPCYVLTTSENSVHVYMWEEGGRHPYLRSCCH    351 - 420
LENTWHDHTTDSCISSVMCDNASIVLRVRKVSDSSILVMYSLNT                              421 - 464
//

Text Mined References (8)

PMID Year Title
26617728 2015 FBXW12, a novel F box protein-encoding gene, is deleted or methylated in some cases of epithelial ovarian cancer.
26171402 2015 The Human IL-22 Receptor Is Regulated through the Action of the Novel E3 Ligase Subunit FBXW12, Which Functions as an Epithelial Growth Suppressor.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
15520277 2004 Systematic analysis and nomenclature of mammalian F-box proteins.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15040455 2004 cDNA cloning and expression analysis of a novel human F-box domain containing gene.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.