Property Summary

NCBI Gene PubMed Count 18
PubMed Score 7.58
PubTator Score 7.60

Knowledge Summary

Patent

No data available

Expression

Protein-protein Interaction (9)

Gene RIF (8)

AA Sequence

MMRTCVLLSAVLWCLTGVQCPRFTLFNKKGFIYGKTGQPDKIYVELHQNSPVLICMDFKLSKKEIVDPTY      1 - 70
LWIGPNEKTLTGNNRINITETGQLMVKDFLEPLSGLYTCTLSYKTVKAETQEEKTVKKRYDFMVFAYREP     71 - 140
DYSYQMAVRFTTRSCIGRYNDVFFRVLKKILDSLISDLSCHVIEPSYKCHSVEIPEHGLIHELFIAFQVN    141 - 210
PFAPGWKGACNGSVDCEDTTNHNILQARDRIEDFFRSQAYIFYHNFNKTLPAMHFVDHSLQVVRLDSCRP    211 - 280
GFGKNERLHSNCASCCVVCSPATFSPDVNVTCQTCVSVLTYGAKSCPQTSNKNQQYED                281 - 338
//

Text Mined References (20)

PMID Year Title