Property Summary

NCBI Gene PubMed Count 18
PubMed Score 6.02
PubTator Score 45.03

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Klinefelter's syndrome 56 0.0 4.0

Expression

  Differential Expression (7)

Disease log2 FC p
adult high grade glioma -1.100 2.0e-02
Astrocytoma, Pilocytic -1.100 1.3e-03
atypical teratoid / rhabdoid tumor -1.900 5.3e-08
glioblastoma -1.300 1.4e-02
group 3 medulloblastoma -2.300 8.2e-04
medulloblastoma, large-cell -1.200 4.4e-03
primitive neuroectodermal tumor -1.300 1.0e-02

Protein-protein Interaction (4)

Gene RIF (6)

AA Sequence

MGAAASRRRALRSEAMSSVAAKVRAARAFGEYLSQSHPENRNGADHLLADAYSGHDGSPEMQPAPQNKRR      1 - 70
LSLVSNGCYEGSLSEEPSIRKPAGEGPQPRVYTISGEPALLPSPEAEAIELAVVKGRRQRHPHHHSQPLR     71 - 140
ASPGGSREDVSRPCQSWAGSRQGSKECPGCAQLAPGPTPRAFGLDQPPLPETSGRRKKLERMYSVDRVSD    141 - 210
DIPIRTWFPKENLFSFQTATTTMQAISVFRGYAERKRRKRENDSASVIQRNFRKHLRMVGSRRVKAQTFA    211 - 280
ERRERSFSRSWSDPTPMKADTSHDSRDSSDLQSSHCTLDEAFEDLDWDTEKGLEAVACDTEGFVPPKVML    281 - 350
ISSKVPKAEYIPTIIRRDDPSIIPILYDHEHATFEDILEEIERKLNVYHKGAKIWKMLIFCQGGPGHLYL    351 - 420
LKNKVATFAKVEKEEDMIHFWKRLSRLMSKVNPEPNVIHIMGCYILGNPNGEKLFQNLRTLMTPYRVTFE    421 - 490
SPLELSAQGKQMIETYFDFRLYRLWKSRQHSKLLDFDDVL                                  491 - 530
//

Text Mined References (19)

PMID Year Title