Property Summary

NCBI Gene PubMed Count 21
PubMed Score 177.84
PubTator Score 17.05

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
active ulcerative colitis -1.194 3.4e-02
astrocytic glioma -1.900 1.0e-02
Astrocytoma, Pilocytic -1.800 1.1e-07
atypical teratoid/rhabdoid tumor 1.400 4.1e-02
Breast cancer -4.700 9.1e-25
breast carcinoma -2.000 3.0e-20
colon cancer -1.800 4.2e-03
Crohn's disease -1.064 2.8e-03
ependymoma -2.000 1.8e-02
gastric carcinoma -3.700 3.9e-02
glioblastoma -2.000 1.6e-06
group 3 medulloblastoma -1.600 6.2e-03
interstitial cystitis -2.900 4.5e-03
intraductal papillary-mucinous adenoma (... 4.100 1.0e-04
lung adenocarcinoma -2.800 1.6e-16
lung carcinoma -2.700 1.0e-11
medulloblastoma, large-cell -1.700 9.4e-04
nephrosclerosis 1.171 3.5e-03
non-small cell lung cancer -1.326 1.1e-03
oligodendroglioma -1.900 1.4e-02
pediatric high grade glioma -1.400 3.1e-05

Gene RIF (12)

AA Sequence

MLPPAIHFYLLPLACILMKSCLAFKNDATEILYSHVVKPVPAHPSSNSTLNQARNGGRHFSNTGLDRNTR      1 - 70
VQVGCRELRSTKYISDGQCTSISPLKELVCAGECLPLPVLPNWIGGGYGTKYWSRRSSQEWRCVNDKTRT     71 - 140
QRIQLQCQDGSTRTYKITVVTACKCKRYTRQHNESSHNFESMSPAKPVQHHRERKRASKSSKHSMS        141 - 206
//

Text Mined References (23)

PMID Year Title