Property Summary

NCBI Gene PubMed Count 21
PubMed Score 165.15
PubTator Score 17.05

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
Breast cancer 3099 9.10764830700038E-25
non-small cell lung carcinoma 413 1.17151436710154E-20
breast carcinoma 1614 2.96232634378914E-20
lung adenocarcinoma 2714 3.1608439398025E-20
lung carcinoma 2844 1.01039682475759E-11
pilocytic astrocytoma 3086 1.29318444878539E-7
glioblastoma 5572 1.63006391237949E-6
pediatric high grade glioma 2712 3.11198986336622E-5
interstitial cystitis 2299 6.77613073065283E-5
intraductal papillary-mucinous adenoma (IPMA) 2956 1.04886371044962E-4
medulloblastoma, large-cell 6234 9.40736738084167E-4
Crohn's disease 304 0.00284218049574207
nephrosclerosis 329 0.00345204772489229
colon cancer 1475 0.00422180425965016
group 3 medulloblastoma 2254 0.00624157236302519
ulcerative colitis 2087 0.0100367114105706
astrocytic glioma 2241 0.010430284690176
oligodendroglioma 2849 0.0139152333938903
ependymoma 2514 0.0176692962906925
gastric carcinoma 832 0.0389738772235667
atypical teratoid/rhabdoid tumor 1095 0.0414618907181957

Expression

  Differential Expression (21)

Disease log2 FC p
nephrosclerosis 1.171 0.003
astrocytic glioma -1.900 0.010
ependymoma -2.000 0.018
oligodendroglioma -1.900 0.014
glioblastoma -2.000 0.000
medulloblastoma, large-cell -1.700 0.001
Crohn's disease -1.064 0.003
ulcerative colitis -1.243 0.010
non-small cell lung carcinoma -2.300 0.000
intraductal papillary-mucinous adenoma (... 4.100 0.000
colon cancer -1.800 0.004
interstitial cystitis -3.600 0.000
lung adenocarcinoma -3.100 0.000
pediatric high grade glioma -1.400 0.000
atypical teratoid/rhabdoid tumor 1.400 0.041
group 3 medulloblastoma -1.600 0.006
pilocytic astrocytoma -1.800 0.000
Breast cancer -4.700 0.000
lung carcinoma -2.700 0.000
breast carcinoma -2.000 0.000
gastric carcinoma -3.700 0.039

Synonym

Accession Q6X4U4 A8MUA6 Q96HJ7 Q9Y3U3
Symbols DAND7
USAG1
CDA019
ECTODIN

Gene

  Ortholog (11)

Gene RIF (12)

PMID Text
26378658 Down-regulation of SOSTDC1 promotes thyroid cancer cell proliferation via regulating cyclin A2 and cyclin E2.
25858146 Epigenetic silencing of SOSTDC1 through methylation is increased in prostate cancer and is associated with accelerated disease progression in patients with prostate cancer
25338303 Results conclude that the transcriptional repressor E4BP4 plays a role in repressing epigenetically regulated SOSTDC1 expression in breast cancer cells, which can be reverted by E4BP4 silencing.
24190897 Unliganded VDR upregulates the expression of hairless, the gene product of which acts as a downstream comodulator to feedback-repress DKKL1 and SOSTDC1.
23830730 DNA methylation is involved in the down-regulation of SOSTDC1 expression in gastric cancer.
21221677 Results indicate for the first time that the genetic polymorphisms in SOSTDC1 have an effect on attainment and maintenance of peak bone mass in Chinese women.
21113658 SOSTDC1 is expressed in normal breast tissue and this expression is reduced in breast cancer.
21080955 genetic aberrations near SOSTDC1 are not uncommon in renal cancer, and occur in adult as well as pediatric renal tumors.
19760604 Loss of SOSTDC1 gene is associated with Wilms tumor.
18032587 This screen identified a bone morphogenetic protein (BMP) antagonist, SOSTDC1 (sclerostin domain-containing-1) as down-regulated in kidney tumors.
More...

AA Sequence

MLPPAIHFYLLPLACILMKSCLAFKNDATEILYSHVVKPVPAHPSSNSTLNQARNGGRHFSNTGLDRNTR      1 - 70
VQVGCRELRSTKYISDGQCTSISPLKELVCAGECLPLPVLPNWIGGGYGTKYWSRRSSQEWRCVNDKTRT     71 - 140
QRIQLQCQDGSTRTYKITVVTACKCKRYTRQHNESSHNFESMSPAKPVQHHRERKRASKSSKHSMS        141 - 206
//

Text Mined References (23)

PMID Year Title
26378658 2015 Down-regulation of SOSTDC1 promotes thyroid cancer cell proliferation via regulating cyclin A2 and cyclin E2.
25858146 2015 Hepcidin regulation in prostate and its disruption in prostate cancer.
25338303 2014 E4BP4 is a repressor of epigenetically regulated SOSTDC1 expression in breast cancer cells.
24190897 2014 Vitamin D receptor-mediated control of Soggy, Wise, and Hairless gene expression in keratinocytes.
23830730 2013 SOSTDC1 down-regulation of expression involves CpG methylation and is a potential prognostic marker in gastric cancer.
21221677 2011 Contribution of the sclerostin domain-containing protein 1 (SOSTDC1) gene to normal variation of peak bone mineral density in Chinese women and men.
21113658 2011 SOSTDC1 differentially modulates Smad and beta-catenin activation and is down-regulated in breast cancer.
21080955 2010 Loss of heterozygosity and SOSTDC1 in adult and pediatric renal tumors.
20339536 2010 Genome-wide association of lipid-lowering response to statins in combined study populations.
19760604 2009 Two candidate tumor suppressor genes, MEOX2 and SOSTDC1, identified in a 7p21 homozygous deletion region in a Wilms tumor.
More...