Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.08

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q6X4T0 Q6X4S9 Q8N5S2
Symbols HSD-29
HSD-30

Gene

 Compartment GO Term (1)

AA Sequence

MAQHPCQDQEQKVEMTSKQQRSTSIEETMRPQEKQVTITETLWDQVLTVFKDIQKELQEDARIRGMSNCS      1 - 70
MTPMTSAPRTGSIRPPDSLMTPKLRRLQFSSGEQPSGGRIHNLKTQLFSQSAYYPGP                  71 - 127
//

Text Mined References (2)

PMID Year Title
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.