Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.08

Knowledge Summary

Patent

No data available

Expression

AA Sequence

MAQHPCQDQEQKVEMTSKQQRSTSIEETMRPQEKQVTITETLWDQVLTVFKDIQKELQEDARIRGMSNCS      1 - 70
MTPMTSAPRTGSIRPPDSLMTPKLRRLQFSSGEQPSGGRIHNLKTQLFSQSAYYPGP                  71 - 127
//

Text Mined References (2)

PMID Year Title