Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.08

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q6X4T0 Q6X4S9 Q8N5S2
Symbols HSD-29
HSD-30

Gene

  Ortholog (1)

Species Source Disease
Cow OMA EggNOG Inparanoid

 Compartment GO Term (1)

AA Sequence

MAQHPCQDQEQKVEMTSKQQRSTSIEETMRPQEKQVTITETLWDQVLTVFKDIQKELQEDARIRGMSNCS      1 - 70
MTPMTSAPRTGSIRPPDSLMTPKLRRLQFSSGEQPSGGRIHNLKTQLFSQSAYYPGP                  71 - 127
//

Text Mined References (2)

PMID Year Title