Property Summary

NCBI Gene PubMed Count 4
PubMed Score 2.89
PubTator Score 0.60

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 8.5e-22
lung adenocarcinoma 2716 7.4e-11
ovarian cancer 8520 1.3e-06
invasive ductal carcinoma 2951 4.5e-03
ductal carcinoma in situ 1745 7.4e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Expression

  Differential Expression (5)

Disease log2 FC p
ductal carcinoma in situ 1.200 7.4e-03
invasive ductal carcinoma 1.800 4.5e-03
lung adenocarcinoma 1.100 7.4e-11
ovarian cancer 1.100 1.3e-06
psoriasis 1.100 8.5e-22

Synonym

Accession Q6WRX3 A6NCK5
Symbols ZYG11

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (2)

AA Sequence

MVHFLHPGHTPRNIVPPDAQKDALGCCVVQEEASPYTLVNICLNVLIANLEKLCSERPDGTLCLPEHWSF      1 - 70
PQEVAERFLRVMTWQGKLTDRTASIFRGNQMKLKLVNIQKAKISTAAFIKAFCRHKLIELNATAVHADLP     71 - 140
VPDIISGLCSNRWIQQNLQCLLLDSTSIPQNSRLLFFSQLTGLRILSVFNVCFHTEDLANVSQLPRLESL    141 - 210
DISNTLVTDISALLTCKDRLKSLTMHYLKCLAMTKSQILAVIRELKCLLHLDISDHRQLKSDLAFHLLQQ    211 - 280
KDILPNVVSLDISGGNCITDEAVELFIRLRPAMQFVGLLATDAGSSDFFTTKQGLRVAGGASMSQISEAL    281 - 350
SRYRNRSCFVKEALHRLFTETFSMEVTMPAILKLVAIGMRNHPLDLRVQFTASACALNLTRQGLAKGMPV    351 - 420
RLLSEVTCLLFKALKNFPHYQQLQKNCLLSLTNSRILVDVPFDRFDAAKFVMRWLCKHENPKMQTMAVSV    421 - 490
TSILALQLSPEQTAQLEELFMAVKELLAIVKQKTTENLDDVTFLFTLKALWNLTDGSPAACKHFIENQGL    491 - 560
QIFIQVLETFSESAIQSKVLGLLNNIAEVRELSSKLVTEDVLKHINSLLCSREMEVSYFAAGIIAHLTSD    561 - 630
RQLWISRDFQRRTLLQDLHATIQNWPSSSCKMTALVTYRSFKTFFPLLGNFSQPEVQLWALWAMYHVCSK    631 - 700
NPSKYCKMLVEEEGLQLLCDIQEHSEATPKAQQIAASILDDFRMHFMNYQRPTLCQMPF               701 - 759
//

Text Mined References (5)

PMID Year Title