Property Summary

NCBI Gene PubMed Count 1
PubMed Score 2.97
PubTator Score 0.60

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
lung adenocarcinoma 1.100 0.000
ductal carcinoma in situ 1.200 0.007
invasive ductal carcinoma 1.800 0.004
ovarian cancer 1.100 0.000
psoriasis 1.100 0.000

AA Sequence

MVHFLHPGHTPRNIVPPDAQKDALGCCVVQEEASPYTLVNICLNVLIANLEKLCSERPDGTLCLPEHWSF      1 - 70
PQEVAERFLRVMTWQGKLTDRTASIFRGNQMKLKLVNIQKAKISTAAFIKAFCRHKLIELNATAVHADLP     71 - 140
VPDIISGLCSNRWIQQNLQCLLLDSTSIPQNSRLLFFSQLTGLRILSVFNVCFHTEDLANVSQLPRLESL    141 - 210
DISNTLVTDISALLTCKDRLKSLTMHYLKCLAMTKSQILAVIRELKCLLHLDISDHRQLKSDLAFHLLQQ    211 - 280
KDILPNVVSLDISGGNCITDEAVELFIRLRPAMQFVGLLATDAGSSDFFTTKQGLRVAGGASMSQISEAL    281 - 350
SRYRNRSCFVKEALHRLFTETFSMEVTMPAILKLVAIGMRNHPLDLRVQFTASACALNLTRQGLAKGMPV    351 - 420
RLLSEVTCLLFKALKNFPHYQQLQKNCLLSLTNSRILVDVPFDRFDAAKFVMRWLCKHENPKMQTMAVSV    421 - 490
TSILALQLSPEQTAQLEELFMAVKELLAIVKQKTTENLDDVTFLFTLKALWNLTDGSPAACKHFIENQGL    491 - 560
QIFIQVLETFSESAIQSKVLGLLNNIAEVRELSSKLVTEDVLKHINSLLCSREMEVSYFAAGIIAHLTSD    561 - 630
RQLWISRDFQRRTLLQDLHATIQNWPSSSCKMTALVTYRSFKTFFPLLGNFSQPEVQLWALWAMYHVCSK    631 - 700
NPSKYCKMLVEEEGLQLLCDIQEHSEATPKAQQIAASILDDFRMHFMNYQRPTLCQMPF               701 - 759
//

Text Mined References (2)

PMID Year Title
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.