Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.00
PubTator Score 2.00

Knowledge Summary

Patent

No data available

Gene RIF (3)

PMID Text
25687183 the current study suggested an underlying mechanism that miR-21 directly target HEPN1 and inhibit its expression during the carcinogenesis of HCC. HEPN1 may thus be a candidate as a therapeutic target for patients with HCC.
25448679 ROS increase production of an alternately spliced form of X-box binding protein 1 (XBP1s) and XBP1s increases HEPN1 expression by binding to the HEPN1 promoter
23548416 HEPN1 silencing increased MMP-2, MMP-9, and Bcl-2 expression, but decreased BAX, p53, and caspase-3 expression.

AA Sequence

MGNWGLGIAPWVDGESELEFRRLGMQGPLEALRRREWNTQRASFSFSFLIALSPHTVDYCHSYELFNRRW      1 - 70
HGHVLATQRPSLFILMLV                                                         71 - 88
//

Text Mined References (7)

PMID Year Title
25687183 2015 MicroRNA-21 promotes cell proliferation in human hepatocellular carcinoma partly by targeting HEPN1.
25448679 2014 Reactive oxygen species increase HEPN1 expression via activation of the XBP1 transcription factor.
23548416 2013 Silencing of HEPN1 is responsible for the aggressive biological behavior of pituitary somatotroph adenomas.
15917256 2005 Structural and functional analyses of a novel ig-like cell adhesion molecule, hepaCAM, in the human breast carcinoma MCF7 cells.
15885354 2005 Cloning and characterization of hepaCAM, a novel Ig-like cell adhesion molecule suppressed in human hepatocellular carcinoma.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12971969 2003 HEPN1, a novel gene that is frequently down-regulated in hepatocellular carcinoma, suppresses cell growth and induces apoptosis in HepG2 cells.