Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.00
PubTator Score 2.00

Knowledge Summary

Patent

No data available

Gene RIF (3)

AA Sequence

MGNWGLGIAPWVDGESELEFRRLGMQGPLEALRRREWNTQRASFSFSFLIALSPHTVDYCHSYELFNRRW      1 - 70
HGHVLATQRPSLFILMLV                                                         71 - 88
//

Text Mined References (7)

PMID Year Title