Property Summary

NCBI Gene PubMed Count 12
Grant Count 11
R01 Count 7
Funding $2,645,011.5
PubMed Score 48.29
PubTator Score 14.75

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Gene RIF (3)

PMID Text
19453261 Observational study of gene-disease association. (HuGE Navigator)
15094188 Differential expression of CHL2 variants was observed during myoblast and osteoblast differentiation, implying a role for this gene in these physiological processes.
14660436 CHL2 expression is restricted to chondrocytes of various developing joint cartilage surfaces and connective tissues in reproductive organs

AA Sequence

MVPEVRVLSSLLGLALLWFPLDSHARARPDMFCLFHGKRYSPGESWHPYLEPQGLMYCLRCTCSEGAHVS      1 - 70
CYRLHCPPVHCPQPVTEPQQCCPKCVEPHTPSGLRAPPKSCQHNGTMYQHGEIFSAHELFPSRLPNQCVL     71 - 140
CSCTEGQIYCGLTTCPEPGCPAPLPLPDSCCQACKDEASEQSDEEDSVQSLHGVRHPQDPCSSDAGRKRG    141 - 210
PGTPAPTGLSAPLSFIPRHFRPKGAGSTTVKIVLKEKHKKACVHGGKTYSHGEVWHPAFRAFGPLPCILC    211 - 280
TCEDGRQDCQRVTCPTEYPCRHPEKVAGKCCKICPEDKADPGHSEISSTRCPKAPGRVLVHTSVSPSPDN    281 - 350
LRRFALEHEASDLVEIYLWKLVKGIFHLTQIKKVRKQDFQKEAQHFRLLAGPHEGHWNVFLAQTLELKVT    351 - 420
ASPDKVTKT                                                                 421 - 429
//

Text Mined References (15)

PMID Year Title
26091039 2015 A Single Kinase Generates the Majority of the Secreted Phosphoproteome.
25575966 2015 Insights into osteoarthritis progression revealed by analyses of both knee tibiofemoral compartments.
25085501 2014 Integrated genome-wide association, coexpression network, and expression single nucleotide polymorphism analysis identifies novel pathway in allergic rhinitis.
22816789 2013 Molecular characterization of central neurocytomas: potential markers for tumor typing and progression.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
18780401 2008 Identification of N-linked glycoproteins in human milk by hydrophilic interaction liquid chromatography and mass spectrometry.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16502470 2006 Human colostrum: identification of minor proteins in the aqueous phase by proteomics.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15340161 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites.
More...