Property Summary

NCBI Gene PubMed Count 25
PubMed Score 14.28
PubTator Score 14.75

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
adult high grade glioma -1.900 1.6e-03
atypical teratoid / rhabdoid tumor -2.300 3.4e-08
glioblastoma -1.900 3.9e-04
medulloblastoma, large-cell -2.100 4.4e-04
Multiple myeloma 1.102 5.2e-04
osteosarcoma 1.413 1.2e-02
ovarian cancer 1.500 4.0e-04
pancreatic ductal adenocarcinoma liver m... 1.144 7.2e-03
primitive neuroectodermal tumor -1.100 1.1e-02
psoriasis -1.100 6.1e-04
spina bifida -1.383 3.7e-02

Gene RIF (6)

AA Sequence

MSAAKENPCRKFQANIFNKSKCQNCFKPRESHLLNDEDLTQAKPIYGGWLLLAPDGTDFDNPVHRSRKWQ      1 - 70
RRFFILYEHGLLRYALDEMPTTLPQGTINMNQCTDVVDGEGRTGQKFSLCILTPEKEHFIRAETKEIVSG     71 - 140
WLEMLMVYPRTNKQNQKKKRKVEPPTPQEPGPAKVAVTSSSSSSSSSSSIPSAEKVPTTKSTLWQEEMRT    141 - 210
KDQPDGSSLSPAQSPSQSQPPAASSLREPGLESKEEESAMSSDRMDCGRKVRVESGYFSLEKTKQDLKAE    211 - 280
EQQLPPPLSPPSPSTPNHRRSQVIEKFEALDIEKAEHMETNAVGPSPSSDTRQGRSEKRAFPRKRDFTNE    281 - 350
APPAPLPDASASPLSPHRRAKSLDRRSTEPSVTPDLLNFKKGWLTKQYEDGQWKKHWFVLADQSLRYYRD    351 - 420
SVAEEAADLDGEIDLSACYDVTEYPVQRNYGFQIHTKEGEFTLSAMTSGIRRNWIQTIMKHVHPTTAPDV    421 - 490
TSSLPEEKNKSSCSFETCPRPTEKQEAELGEPDPEQKRSRARERRREGRSKTFDWAEFRPIQQALAQERV    491 - 560
GGVGPADTHEPLRPEAEPGELERERARRREERRKRFGMLDATDGPGTEDAALRMEVDRSPGLPMSDLKTH    561 - 630
NVHVEIEQRWHQVETTPLREEKQVPIAPVHLSSEDGGDRLSTHELTSLLEKELEQSQKEASDLLEQNRLL    631 - 700
QDQLRVALGREQSAREGYVLQATCERGFAAMEETHQKKIEDLQRQHQRELEKLREEKDRLLAEETAATIS    701 - 770
AIEAMKNAHREEMERELEKSQRSQISSVNSDVEALRRQYLEELQSVQRELEVLSEQYSQKCLENAHLAQA    771 - 840
LEAERQALRQCQRENQELNAHNQELNNRLAAEITRLRTLLTGDGGGEATGSPLAQGKDAYELEVLLRVKE    841 - 910
SEIQYLKQEISSLKDELQTALRDKKYASDKYKDIYTELSIAKAKADCDISRLKEQLKAATEALGEKSPDS    911 - 980
ATVSGYDIMKSKSNPDFLKKDRSCVTRQLRNIRSKSVIEQVSWDT                             981 - 1025
//

Text Mined References (35)

PMID Year Title