Property Summary

NCBI Gene PubMed Count 24
Grant Count 73
R01 Count 46
Funding $6,492,382.6
PubMed Score 13.16
PubTator Score 14.75

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
Multiple myeloma 1.102 0.001
psoriasis -2.100 0.000
osteosarcoma 1.413 0.012
atypical teratoid / rhabdoid tumor -2.300 0.000
glioblastoma -1.900 0.000
medulloblastoma, large-cell -2.100 0.000
primitive neuroectodermal tumor -1.100 0.011
pancreatic ductal adenocarcinoma liver m... 1.144 0.007
adult high grade glioma -1.900 0.002
spina bifida -1.446 0.036
ovarian cancer 1.500 0.000

Synonym

Accession Q6WCQ1 Q3KQZ5 Q5FB94 Q6DHW2 Q7Z5Y2 Q8N390 Q96G40 M-RIP
Symbols MRIP
RIP3
M-RIP
RHOIP3
p116Rip

Gene

Gene RIF (6)

PMID Text
24901049 The B-Raf(V600E) inhibitor dabrafenib selectively inhibits RIP3 and alleviates acetaminophen-induced liver injury.
22349701 Our data identify M-RIP as a crucial local regulator of the Rho-Rac balance during chemotaxis and antigen recognition.
21242312 MLCP (myosin light chain phosphatase) activation is counteracted by a previously unrecognized association between MRIP and the inducible kinase NUAK2
18636174 A functional analysis of JNK1 and M-RIP with RNA interference reveals a critical role for this cascade in the invasive behavior of cancer cells.
16257966 M-RIP-dependent targeting of myosin phosphatase to stress fibers has an important role in regulating myosin light chain phosphorylation state and morphology in human vascular smooth muscle cells
15545284 p116Rip is an important regulatory component that controls the RhoA signaling pathway, thus regulating MLCP activity and myosin phosphorylation in cells

AA Sequence

MSAAKENPCRKFQANIFNKSKCQNCFKPRESHLLNDEDLTQAKPIYGGWLLLAPDGTDFDNPVHRSRKWQ      1 - 70
RRFFILYEHGLLRYALDEMPTTLPQGTINMNQCTDVVDGEGRTGQKFSLCILTPEKEHFIRAETKEIVSG     71 - 140
WLEMLMVYPRTNKQNQKKKRKVEPPTPQEPGPAKVAVTSSSSSSSSSSSIPSAEKVPTTKSTLWQEEMRT    141 - 210
KDQPDGSSLSPAQSPSQSQPPAASSLREPGLESKEEESAMSSDRMDCGRKVRVESGYFSLEKTKQDLKAE    211 - 280
EQQLPPPLSPPSPSTPNHRRSQVIEKFEALDIEKAEHMETNAVGPSPSSDTRQGRSEKRAFPRKRDFTNE    281 - 350
APPAPLPDASASPLSPHRRAKSLDRRSTEPSVTPDLLNFKKGWLTKQYEDGQWKKHWFVLADQSLRYYRD    351 - 420
SVAEEAADLDGEIDLSACYDVTEYPVQRNYGFQIHTKEGEFTLSAMTSGIRRNWIQTIMKHVHPTTAPDV    421 - 490
TSSLPEEKNKSSCSFETCPRPTEKQEAELGEPDPEQKRSRARERRREGRSKTFDWAEFRPIQQALAQERV    491 - 560
GGVGPADTHEPLRPEAEPGELERERARRREERRKRFGMLDATDGPGTEDAALRMEVDRSPGLPMSDLKTH    561 - 630
NVHVEIEQRWHQVETTPLREEKQVPIAPVHLSSEDGGDRLSTHELTSLLEKELEQSQKEASDLLEQNRLL    631 - 700
QDQLRVALGREQSAREGYVLQATCERGFAAMEETHQKKIEDLQRQHQRELEKLREEKDRLLAEETAATIS    701 - 770
AIEAMKNAHREEMERELEKSQRSQISSVNSDVEALRRQYLEELQSVQRELEVLSEQYSQKCLENAHLAQA    771 - 840
LEAERQALRQCQRENQELNAHNQELNNRLAAEITRLRTLLTGDGGGEATGSPLAQGKDAYELEVLLRVKE    841 - 910
SEIQYLKQEISSLKDELQTALRDKKYASDKYKDIYTELSIAKAKADCDISRLKEQLKAATEALGEKSPDS    911 - 980
ATVSGYDIMKSKSNPDFLKKDRSCVTRQLRNIRSKSVIEQVSWDT                             981 - 1025
//

Text Mined References (34)

PMID Year Title
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
24901049 2014 The B-Raf(V600E) inhibitor dabrafenib selectively inhibits RIP3 and alleviates acetaminophen-induced liver injury.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23382691 2013 Loci associated with N-glycosylation of human immunoglobulin G show pleiotropy with autoimmune diseases and haematological cancers.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22349701 2012 Association of syntenin-1 with M-RIP polarizes Rac-1 activation during chemotaxis and immune interactions.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21441570 2011 Genome-wide meta-analysis for severe diabetic retinopathy.
21423176 2011 Analysis of the myosin-II-responsive focal adhesion proteome reveals a role for ?-Pix in negative regulation of focal adhesion maturation.
More...