Property Summary

Ligand Count 12
NCBI Gene PubMed Count 85
PubMed Score 165.61
PubTator Score 113.53

Knowledge Summary

Patent (6,027)

Gene RIF (89)

AA Sequence

MPANFTEGSFDSSGTGQTLDSSPVACTETVTFTEVVEGKEWGSFYYSFKTEQLITLWVLFVFTIVGNSVV      1 - 70
LFSTWRRKKKSRMTFFVTQLAITDSFTGLVNILTDINWRFTGDFTAPDLVCRVVRYLQVVLLYASTYVLV     71 - 140
SLSIDRYHAIVYPMKFLQGEKQARVLIVIAWSLSFLFSIPTLIIFGKRTLSNGEVQCWALWPDDSYWTPY    141 - 210
MTIVAFLVYFIPLTIISIMYGIVIRTIWIKSKTYETVISNCSDGKLCSSYNRGLISKAKIKAIKYSIIII    211 - 280
LAFICCWSPYFLFDILDNFNLLPDTQERFYASVIIQNLPALNSAINPLIYCVFSSSISFPCREQRSQDSR    281 - 350
MTFRERTERHEMQILSKPEFI                                                     351 - 371
//

Text Mined References (86)

PMID Year Title