Property Summary

NCBI Gene PubMed Count 82
Grant Count 22
R01 Count 15
Funding $5,870,911.55
PubMed Score 156.54
PubTator Score 113.53

Knowledge Summary

Patent (6,027)

MLP Assay (14)

AID Type Active / Inconclusive / Inactive Description
1461 confirmatory 2314 / 12627 / 206429 qHTS Assay for Antagonists of the Neuropeptide S Receptor: cAMP Signal Transduction
1464 summary 11 / 0 / 0 Quantitative High-Throughput Screen for Antagonists of the Neuropeptide S Receptor: Summary
1489 confirmatory 31 / 92 / 90 Confirmation Concentration-Response Assay for Antagonists of the Neuropeptide S Receptor: Calcium Signal Transduction
1491 confirmatory 71 / 72 / 116 Confirmation Concentration-Response Assay for Antagonists of the Neuropeptide S Receptor: cAMP Signal Transduction
1493 confirmatory 12 / 4 / 0 Confirmation Concentration-Response Assay for Antagonists of the Neuropeptide S Receptor: Radioligand Displacement
2566 confirmatory 16 / 4 / 0 Confirmation Concentration-Response Assay for Antagonists of the Neuropeptide S Receptor: Radioligand Displacement, SAR for Probe
2567 confirmatory 59 / 60 / 67 Confirmation Concentration-Response Assay for Antagonists of the Neuropeptide S Receptor: Calcium Signal Transduction, SAR for Probe
2568 confirmatory 70 / 38 / 78 Confirmation Concentration-Response Assay for Antagonists of the Neuropeptide S Receptor: cAMP Signal Transduction, SAR for Probe
434931 confirmatory 73 / 15 / 9 Confirmation Concentration-Response Assay for Antagonists of the Neuropeptide S Receptor: Robust Characterization of Calcium Signal Transduction
434936 confirmatory 73 / 14 / 10 Confirmation Concentration-Response Assay for Antagonists of the Neuropeptide S Receptor: Robust Characterization of cAMP Signal Transduction
More...

Gene RIF (86)

PMID Text
26865629 findings demonstrate that hNPS-(1-10) is a biased agonist favoring Galphaq-dependent signaling. It may represent a valuable chemical probe for further investigation of the therapeutic potential of human NPS receptor-directed signalingin vivo.
26235955 Results suggest the functional NPSR1 gene A/T variant to influence glutamate+glutamine concentrations in the bilateral anterior cingulate cortex in healthy male subjects during CCK-4 induced panic
25971599 anxiety sensitivity correlated negatively with prefrontal activity in NPSR1 rs324981 carriers possibly suggesting a decompensation of the adaptive compensatory upregulation
25842293 The results suggest neuropeptide S receptor gene variation to be associated with alterations of prefrontal functioning in the attentional functions alerting and executive control partly modulated by anxiety sensitivity.
25744621 The T-allele of the NPSR1 rs324981 polymorphism is associated with increased impulsivity and ADHD-related traits in non-clinical cohorts.
25091462 Genetic variation at the NPSR1 locus impacts children's predisposition to ecurrent abdominal pain episodes in a Swedish population.
24915894 Neuropeptide S receptor 1 (NPSR1) activates cancer-related pathways and is widely expressed in neuroendocrine tumors.
24896296 The functional SNP rs324981 located in the gene of NPSR1 was significantly associated with objectively obtained sleep parameters in a sample of elderly white subjects
24800784 study provides first evidence for the assumption that a NPSR1 variant modulates brain activation under stress, interacting with the environmental risk factor urban upbringing
24754478 Results show that NPSR1 polymorphism is associated with AUD and alcohol consumption, dependent on sex, environment and age.
More...

AA Sequence

MPANFTEGSFDSSGTGQTLDSSPVACTETVTFTEVVEGKEWGSFYYSFKTEQLITLWVLFVFTIVGNSVV      1 - 70
LFSTWRRKKKSRMTFFVTQLAITDSFTGLVNILTDINWRFTGDFTAPDLVCRVVRYLQVVLLYASTYVLV     71 - 140
SLSIDRYHAIVYPMKFLQGEKQARVLIVIAWSLSFLFSIPTLIIFGKRTLSNGEVQCWALWPDDSYWTPY    141 - 210
MTIVAFLVYFIPLTIISIMYGIVIRTIWIKSKTYETVISNCSDGKLCSSYNRGLISKAKIKAIKYSIIII    211 - 280
LAFICCWSPYFLFDILDNFNLLPDTQERFYASVIIQNLPALNSAINPLIYCVFSSSISFPCREQRSQDSR    281 - 350
MTFRERTERHEMQILSKPEFI                                                     351 - 371
//

Text Mined References (83)

PMID Year Title
26865629 2016 Human Neuropeptide S Receptor Is Activated via a G?q Protein-biased Signaling Cascade by a Human Neuropeptide S Analog Lacking the C-terminal 10 Residues.
26235955 2015 Neuropeptide S receptor gene variation modulates anterior cingulate cortex Glx levels during CCK-4 induced panic.
25971599 2015 Neuropeptide S receptor gene variation and neural correlates of cognitive emotion regulation.
25842293 2015 Modulation of prefrontal functioning in attention systems by NPSR1 gene variation.
25744621 2015 Further evidence for the association of the NPSR1 gene A/T polymorphism (Asn107Ile) with impulsivity and hyperactivity.
25091462 2014 NPSR1 polymorphisms influence recurrent abdominal pain in children: a population-based study.
24915894 2014 Neuropeptide S receptor 1 (NPSR1) activates cancer-related pathways and is widely expressed in neuroendocrine tumors.
24896296 2014 Genetic association of objective sleep phenotypes with a functional polymorphism in the neuropeptide S receptor gene.
24800784 2014 A functional variant in the neuropeptide S receptor 1 gene moderates the influence of urban upbringing on stress processing in the amygdala.
24754478 2015 Neuropeptide S receptor gene variant and environment: contribution to alcohol use disorders and alcohol consumption.
More...