Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Hemangioma 35 3.024 1.5

Synonym

Accession Q6W349
Symbols C4orf11

Gene

 Compartment GO Term (0)

Gene RIF (1)

PMID Text
15218245 One transcript expressed exclusively in retina and retinal pigment epithelium is the novel gene C4orf11 which is comprised of four exons on chromosome 4q21.2

AA Sequence

MPTSETSWWPGACLCSSCAWTSDSRFFNLWTLGLAPAASQGFSGLKPQTDDCTVSFPGFEAFGLGLSHYW      1 - 70
HLSFPACRQSIMGLCLVIVLANSS                                                   71 - 94
//

Text Mined References (1)

PMID Year Title
15218245 2004 Identifying differentially expressed genes in the mammalian retina and the retinal pigment epithelium by suppression subtractive hybridization.