Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00
PubTator Score 1.00

Knowledge Summary

Patent

No data available

Gene RIF (1)

AA Sequence

MPTSETSWWPGACLCSSCAWTSDSRFFNLWTLGLAPAASQGFSGLKPQTDDCTVSFPGFEAFGLGLSHYW      1 - 70
HLSFPACRQSIMGLCLVIVLANSS                                                   71 - 94
//

Text Mined References (1)

PMID Year Title