Property Summary

NCBI Gene PubMed Count 47
Grant Count 52
R01 Count 40
Funding $6,382,302.31
PubMed Score 94.52
PubTator Score 64.37

Knowledge Summary

Patent

No data available

Expression

 GO Component (2)

Gene RIF (29)

PMID Text
27000436 Report mutually exclusive BCOR internal tandem duplications and YWHAE-NUTM2 fusions in clear cell sarcoma of kidney.
26752546 The present study further expands the genetic spectrum of small blue round cell tumors, with 2 novel fusions, BCOR-MAML3 and ZC3H7B-BCOR, identified
26573325 Somatic internal tandem duplications (ITDs) clustering in the C terminus of BCOR were found in 85% of pediatric clear cell sarcoma of the kidney. Mutant BCOR transcripts and proteins are markedly upregulated in ITD-positive tumours.
26516930 Data suggest the detection of the partial duplication inside exon 15 of proto-oncogene protein BCOR as part of the diagnostic process of pediatric kidney tumors.
26098867 Data indicate that the internal tandem duplications in the BCOR gene (BCL6 corepressor) affecting the C terminus in 100% (20/20) of clear cell sarcoma of the kidney (CCSK) tumors
26054978 Using reported human BCOR mutations in patients with oculofaciocardiodental syndrome, the authors identified nuclear localization signals at two possible sites; at aa1131-1141 (NLS1) and at aa1158-1167(NLS2).
25596268 study concluded that in pediatric acute myeloid leukemia, BCOR and BCORL1 mutations rarely occur
25490446 findings identify the BCL6/BCOR/SIRT1 complex as a potent repressor of the SHH pathway in normal and oncogenic neural development
25360585 This study adds to recent reports on the clinicopathologic spectrum of BCOR-CCNB3 fusion-positive sarcomas, a newly emerging entity within the undifferentiated unclassified sarcoma category
24805859 Study provides a detailed description of the histologic spectrum, immunohistochemical features, and clinical characteristic of BCOR-CCNB3 sarcoma justifying distinction from Ewing sarcoma with its typical EWS/FUS-ETS translocations.
More...

AA Sequence

MLSATPLYGNVHSWMNSERVRMCGASEDRKILVNDGDASKARLELREENPLNHNVVDASTAHRIDGLAAL      1 - 70
SMDRTGLIREGLRVPGNIVYSSLCGLGSEKGREAATSTLGGLGFSSERNPEMQFKPNTPETVEASAVSGK     71 - 140
PPNGFSAIYKTPPGIQKSAVATAEALGLDRPASDKQSPLNINGASYLRLPWVNPYMEGATPAIYPFLDSP    141 - 210
NKYSLNMYKALLPQQSYSLAQPLYSPVCTNGERFLYLPPPHYVGPHIPSSLASPMRLSTPSASPAIPPLV    211 - 280
HCADKSLPWKMGVSPGNPVDSHAYPHIQNSKQPRVPSAKAVTSGLPGDTALLLPPSPRPSPRVHLPTQPA    281 - 350
ADTYSEFHKHYARISTSPSVALSKPYMTVSSEFPAARLSNGKYPKAPEGGEGAQPVPGHARKTAVQDRKD    351 - 420
GSSPPLLEKQTVTKDVTDKPLDLSSKVVDVDASKADHMKKMAPTVLVHSRAGSGLVLSGSEIPKETLSPP    421 - 490
GNGCAIYRSEIISTAPSSWVVPGPSPNEENNGKSMSLKNKALDWAIPQQRSSSCPRMGGTDAVITNVSGS    491 - 560
VSSAGRPASASPAPNANADGTKTSRSSVETTPSVIQHVGQPPATPAKHSSSTSSKGAKASNPEPSFKANE    561 - 630
NGLPPSSIFLSPNEAFRSPPIPYPRSYLPYPAPEGIAVSPLSLHGKGPVYPHPVLLPNGSLFPGHLAPKP    631 - 700
GLPYGLPTGRPEFVTYQDALGLGMVHPMLIPHTPIEITKEEKPERRSRSHERARYEDPTLRNRFSEILET    701 - 770
SSTKLHPDVPTDKNLKPNPNWNQGKTVVKSDKLVYVDLLREEPDAKTDTNVSKPSFAAESVGQSAEPPKP    771 - 840
SVEPALQQHRDFIALREELGRISDFHETYTFKQPVFTVSKDSVLAGTNKENLGLPVSTPFLEPPLGSDGP    841 - 910
AVTFGKTQEDPKPFCVGSAPPSVDVTPTYTKDGADEAESNDGKVLKPKPSKLAKRIANSAGYVGDRFKCV    911 - 980
TTELYADSSQLSREQRALQMEGLQEDSILCLPAAYCERAMMRFSELEMKEREGGHPATKDSEMCKFSPAD    981 - 1050
WERLKGNQDKKPKSVTLEEAIAEQNESERCEYSVGNKHRDPFEAPEDKDLPVEKYFVERQPVSEPPADQV   1051 - 1120
ASDMPHSPTLRVDRKRKVSGDSSHTETTAEEVPEDPLLKAKRRRVSKDDWPEREMTNSSSNHLEDPHYSE   1121 - 1190
LTNLKVCIELTGLHPKKQRHLLHLRERWEQQVSAADGKPGRQSRKEVTQATQPEAIPQGTNITEEKPGRK   1191 - 1260
RAEAKGNRSWSEESLKPSDNEQGLPVFSGSPPMKSLSSTSAGGKKQAQPSCAPASRPPAKQQKIKENQKT   1261 - 1330
DVLCADEEEDCQAASLLQKYTDNSEKPSGKRLCKTKHLIPQESRRGLPLTGEYYVENADGKVTVRRFRKR   1331 - 1400
PEPSSDYDLSPAKQEPKPFDRLQQLLPASQSTQLPCSSSPQETTQSRPMPPEARRLIVNKNAGETLLQRA   1401 - 1470
ARLGYEEVVLYCLENKICDVNHRDNAGYCALHEACARGWLNIVRHLLEYGADVNCSAQDGTRPLHDAVEN   1471 - 1540
DHLEIVRLLLSYGADPTLATYSGRTIMKMTHSELMEKFLTDYLNDLQGRNDDDASGTWDFYGSSVCEPDD   1541 - 1610
ESGYDVLANPPGPEDQDDDDDAYSDVFEFEFSETPLLPCYNIQVSVAQGPRNWLLLSDVLKKLKMSSRIF   1611 - 1680
RCNFPNVEIVTIAEAEFYRQVSASLLFSCSKDLEAFNPESKELLDLVEFTNEIQTLLGSSVEWLHPSDLA   1681 - 1750
SDNYW                                                                    1751 - 1755
//

Text Mined References (55)

PMID Year Title
27000436 2016 Mutually exclusive BCOR internal tandem duplications and YWHAE-NUTM2 fusions in clear cell sarcoma of kidney: not the full story.
26752546 2016 Novel BCOR-MAML3 and ZC3H7B-BCOR Gene Fusions in Undifferentiated Small Blue Round Cell Sarcomas.
26687479 2015 The variant Polycomb Repressor Complex 1 component PCGF1 interacts with a pluripotency sub-network that includes DPPA4, a regulator of embryogenesis.
26573325 2015 Recurrent internal tandem duplications of BCOR in clear cell sarcoma of the kidney.
26516930 2015 Whole transcriptome sequencing identifies BCOR internal tandem duplication as a common feature of clear cell sarcoma of the kidney.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26098867 2015 Consistent in-frame internal tandem duplications of BCOR characterize clear cell sarcoma of the kidney.
26054978 2015 Identification of nuclear localization signals within the human BCOR protein.
25596268 2015 BCOR and BCORL1 mutations in pediatric acute myeloid leukemia.
25490446 2014 A BCL6/BCOR/SIRT1 complex triggers neurogenesis and suppresses medulloblastoma by repressing Sonic Hedgehog signaling.
More...