Property Summary

NCBI Gene PubMed Count 14
PubMed Score 48.86
PubTator Score 141.48

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Neoplasms, Germ Cell and Embryonal 15 0.0 0.0
Disease Target Count P-value
facioscapulohumeral dystrophy 288 2.0e-13
Disease Target Count Z-score Confidence
Seminoma 15 3.4 1.7

Expression

  Differential Expression (1)

Disease log2 FC p
facioscapulohumeral dystrophy 4.400 2.0e-13

Synonym

Accession Q6W0C5 Q0P5U3 Q6JZS6
Symbols Pgc7
STELLA

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (10)

AA Sequence

MDPSQFNPTYIPGSPQMLTEENSRDDSGASQISSETLIKNLSNLTINASSESVSPLSEALLRRESVGAAV      1 - 70
LREIEDEWLYSRRGVRTLLSVQREKMARLRYMLLGGVRTHERRPTNKEPKGVKKESRPFKCPCSFCVSNG     71 - 140
WDPSENARIGNQDTKPLQP                                                       141 - 159
//

Text Mined References (14)

PMID Year Title