Property Summary

NCBI Gene PubMed Count 12
Grant Count 12
Funding $3,701,987.67
PubMed Score 47.40
PubTator Score 141.48

Knowledge Summary

Patent

No data available

TINX Plot

Gene RIF (8)

PMID Text
26608031 Data suggest enforced expression of Stella into normal cells induces not only global DNA demethylation but also neoplastic transformation and increases metastatic ability; these changes involve altered regulation of neoplastic gene expression.
25280994 Considering that impaired DNA methylation profiles are associated with various developmental or disease phenomena, Stella may be a powerful tool with which to study the biological effects of global DNA hypomethylation
23457636 a role for STELLA in facilitating germline and endodermal differentiation of human ES cells
17143267 These results demonstrate that PGC7/Stella is indispensable for the maintenance of methylation involved in epigenetic reprogramming after fertilization.
16291741 human adult tissue-specific transcripts originate via retrotransposition of the pluripotent cell-specific gene, Dppa3
15018652 In mice, knockout experiments show this gene may be a maternal factor in cleavage stage embryogenesis.
14654002 In mice, a targeted mutation results in reduced female fertility and may function as a mammalian maternal effect gene.
11900980 In mice, this gene may play a role in oogenesis and primordial germ cell development.

AA Sequence

MDPSQFNPTYIPGSPQMLTEENSRDDSGASQISSETLIKNLSNLTINASSESVSPLSEALLRRESVGAAV      1 - 70
LREIEDEWLYSRRGVRTLLSVQREKMARLRYMLLGGVRTHERRPTNKEPKGVKKESRPFKCPCSFCVSNG     71 - 140
WDPSENARIGNQDTKPLQP                                                       141 - 159
//

Text Mined References (12)

PMID Year Title
26608031 2015 Global DNA hypomethylation coupled to cellular transformation and metastatic ability.
25280994 2014 Inhibition of maintenance DNA methylation by Stella.
23457636 2013 STELLA facilitates differentiation of germ cell and endodermal lineages of human embryonic stem cells.
21421998 2011 NANOS3 function in human germ cell development.
17143267 2007 PGC7/Stella protects against DNA demethylation in early embryogenesis.
16291741 2006 Adult tissue-specific expression of a Dppa3-derived retrogene represents a postnatal transcript of pluripotent cell origin.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15018652 2004 Dppa3 / Pgc7 / stella is a maternal factor and is not required for germ cell specification in mice.
14990856 2004 Human STELLAR, NANOG, and GDF3 genes are expressed in pluripotent cells and map to chromosome 12p13, a hotspot for teratocarcinoma.
14684992 2003 Dppa3 is a marker of pluripotency and has a human homologue that is expressed in germ cell tumours.
More...