Property Summary

NCBI Gene PubMed Count 24
PubMed Score 24.85
PubTator Score 29.89

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (3)

Disease log2 FC p
psoriasis -1.300 2.9e-04
breast carcinoma 1.300 4.0e-02
lung adenocarcinoma 1.100 5.2e-04

Gene RIF (25)

PMID Text
25915798 Interaction of HIV-1 Nef with PACS-1 occurs in cellular endosomes with markers RAB5 and LAMP-1
25589658 Interaction of HIV-1 Nef with PACS-1 occurs in cellular endosomes with markers RAB5 and LAMP-1
24001769 PACS1 plays an important role in protein sorting for amyloidogenic-burden control via both SORLA-dependent and SORLA-independent mechanisms.
23563609 Single nucleotide polymorphisms in PAKS1 gene is associated with obesity.
23559827 Interaction of HIV-1 Nef with PACS-1 occurs in cellular endosomes with markers RAB5 and LAMP-1
23159249 Our findings suggest that PACS1 is necessary for the formation of craniofacial structures and that perturbation of its functions results in a specific syndromic ID phenotype.
22496420 The sites on Nef and the PACS proteins required for their interaction, are identified.
22496420 Interaction of HIV-1 Nef with PACS-1 occurs in cellular endosomes with markers RAB5 and LAMP-1
20702582 Interaction of HIV-1 Nef with PACS-1 occurs in cellular endosomes with markers RAB5 and LAMP-1
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19710307 PACS-1 mediates phosphorylation-dependent ciliary trafficking of the CNGB1b in olfactory sensory neurons.
19149577 Interaction of HIV-1 Nef with PACS-1 occurs in cellular endosomes with markers RAB5 and LAMP-1
18653452 Interaction of HIV-1 Nef with PACS-1 occurs in cellular endosomes with markers RAB5 and LAMP-1
18005690 Interaction of HIV-1 Nef with PACS-1 occurs in cellular endosomes with markers RAB5 and LAMP-1
16977309 CK2-activated phosphorylation cascade controlling PACS-1- and GGA3-mediated CI-MPR sorting, is reported.
16308564 casein kinase 2 induces PACS-1 binding of nephrocystin and targeting to cilia
15692563 subcellular localization and function of polycystin-2 are directed by phosphofurin acidic cluster sorting protein (PACS)-1 and PACS-2
15638726 Interaction of HIV-1 Nef with PACS-1 occurs in cellular endosomes with markers RAB5 and LAMP-1
14965316 Interaction of HIV-1 Nef with PACS-1 occurs in cellular endosomes with markers RAB5 and LAMP-1
12855553 Interaction of HIV-1 Nef with PACS-1 occurs in cellular endosomes with markers RAB5 and LAMP-1
12526811 PACS-1 along with HIV-1 nef, has a role in downregulating cell surface MHC-I to the trans-Golgi network and usurping the ARF6 endocytic pathway
12526811 Interaction of HIV-1 Nef with PACS-1 occurs in cellular endosomes with markers RAB5 and LAMP-1
11463741 Interaction of HIV-1 Nef with PACS-1 occurs in cellular endosomes with markers RAB5 and LAMP-1
11331585 Interaction of HIV-1 Nef with PACS-1 occurs in cellular endosomes with markers RAB5 and LAMP-1
10707087 Interaction of HIV-1 Nef with PACS-1 occurs in cellular endosomes with markers RAB5 and LAMP-1

AA Sequence

MAERGGAGGGPGGAGGGSGQRGSGVAQSPQQPPPQQQQQQPPQQPTPPKLAQATSSSSSTSAAAASSSSS      1 - 70
STSTSMAVAVASGSAPPGGPGPGRTPAPVQMNLYATWEVDRSSSSCVPRLFSLTLKKLVMLKEMDKDLNS     71 - 140
VVIAVKLQGSKRILRSNEIVLPASGLVETELQLTFSLQYPHFLKRDANKLQIMLQRRKRYKNRTILGYKT    141 - 210
LAVGLINMAEVMQHPNEGALVLGLHSNVKDVSVPVAEIKIYSLSSQPIDHEGIKSKLSDRSPDIDNYSEE    211 - 280
EEESFSSEQEGSDDPLHGQDLFYEDEDLRKVKKTRRKLTSTSAITRQPNIKQKFVALLKRFKVSDEVGFG    281 - 350
LEHVSREQIREVEEDLDELYDSLEMYNPSDSGPEMEETESILSTPKPKLKPFFEGMSQSSSQTEIGSLNS    351 - 420
KGSLGKDTTSPMELAALEKIKSTWIKNQDDSLTETDTLEITDQDMFGDASTSLVVPEKVKTPMKSSKTDL    421 - 490
QGSASPSKVEGVHTPRQKRSTPLKERQLSKPLSERTNSSDSERSPDLGHSTQIPRKVVYDQLNQILVSDA    491 - 560
ALPENVILVNTTDWQGQYVAELLQDQRKPVVCTCSTVEVQAVLSALLTRIQRYCNCNSSMPRPVKVAAVG    561 - 630
GQSYLSSILRFFVKSLANKTSDWLGYMRFLIIPLGSHPVAKYLGSVDSKYSSSFLDSGWRDLFSRSEPPV    631 - 700
SEQLDVAGRVMQYVNGAATTHQLPVAEAMLTCRHKFPDEDSYQKFIPFIGVVKVGLVEDSPSTAGDGDDS    701 - 770
PVVSLTVPSTSPPSSSGLSRDATATPPSSPSMSSALAIVGSPNSPYGDVIGLQVDYWLGHPGERRREGDK    771 - 840
RDASSKNTLKSVFRSVQVSRLPHSGEAQLSGTMAMTVVTKEKNKKVPTIFLSKKPREKEVDSKSQVIEGI    841 - 910
SRLICSAKQQQTMLRVSIDGVEWSDIKFFQLAAQWPTHVKHFPVGLFSGSKAT                     911 - 963
//

Text Mined References (35)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24001769 2013 SORLA-dependent and -independent functions for PACS1 in control of amyloidogenic processes.
23563609 2013 Genome-wide SNP and CNV analysis identifies common and low-frequency variants associated with severe early-onset obesity.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23159249 2012 Recurrent de novo mutations in PACS1 cause defective cranial-neural-crest migration and define a recognizable intellectual-disability syndrome.
22740416 2012 Characterization and intracellular trafficking of Epstein-Barr virus BBLF1, a protein involved in virion maturation.
22496420 2012 An interdomain binding site on HIV-1 Nef interacts with PACS-1 and PACS-2 on endosomes to down-regulate MHC-I.
21926972 2011 Large-scale genome-wide association analysis of bipolar disorder identifies a new susceptibility locus near ODZ4.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19710307 2009 PACS-1 mediates phosphorylation-dependent ciliary trafficking of the cyclic-nucleotide-gated channel in olfactory sensory neurons.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18296443 2008 HIV-1 Nef binds PACS-2 to assemble a multikinase cascade that triggers major histocompatibility complex class I (MHC-I) down-regulation: analysis using short interfering RNA and knock-out mice.
17855360 2007 SorLA/LR11 regulates processing of amyloid precursor protein via interaction with adaptors GGA and PACS-1.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
16977309 2006 A PACS-1, GGA3 and CK2 complex regulates CI-MPR trafficking.
16308564 2005 Phosphorylation by casein kinase 2 induces PACS-1 binding of nephrocystin and targeting to cilia.
15692563 2005 Trafficking of TRPP2 by PACS proteins represents a novel mechanism of ion channel regulation.
15569716 2004 HIV-1 Nef disrupts MHC-I trafficking by recruiting AP-1 to the MHC-I cytoplasmic tail.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14633983 2003 The phosphorylation state of an autoregulatory domain controls PACS-1-directed protein traffic.
14608369 2003 AP-1 recruitment to VAMP4 is modulated by phosphorylation-dependent binding of PACS-1.
12855553 2003 Signaling but not trafficking function of HIV-1 protein Nef is essential for Nef-induced defects in human intrathymic T-cell development.
12526811 2002 HIV-1 Nef downregulates MHC-I by a PACS-1- and PI3K-regulated ARF6 endocytic pathway.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11331585 2001 PACS-1 binding to adaptors is required for acidic cluster motif-mediated protein traffic.
10707087 2000 HIV-1 Nef protein binds to the cellular protein PACS-1 to downregulate class I major histocompatibility complexes.
10574461 1999 Characterization of cDNA clones selected by the GeneMark analysis from size-fractionated cDNA libraries from human brain.
9695949 1998 PACS-1 defines a novel gene family of cytosolic sorting proteins required for trans-Golgi network localization.