Property Summary

NCBI Gene PubMed Count 66
PubMed Score 95.43
PubTator Score 75.46

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
group 3 medulloblastoma 1.400 5.2e-04
intraductal papillary-mucinous adenoma (... 1.800 2.1e-05
intraductal papillary-mucinous carcinoma... 1.300 1.4e-03
osteosarcoma -1.341 4.4e-05
ovarian cancer -1.600 9.6e-09
Pick disease -1.200 1.9e-05

Gene RIF (61)

AA Sequence

MWKLWRAEEGAAALGGALFLLLFALGVRQLLKQRRPMGFPPGPPGLPFIGNIYSLAASSELPHVYMRKQS      1 - 70
QVYGEIFSLDLGGISTVVLNGYDVVKECLVHQSEIFADRPCLPLFMKMTKMGGLLNSRYGRGWVDHRRLA     71 - 140
VNSFRYFGYGQKSFESKILEETKFFNDAIETYKGRPFDFKQLITNAVSNITNLIIFGERFTYEDTDFQHM    141 - 210
IELFSENVELAASASVFLYNAFPWIGILPFGKHQQLFRNAAVVYDFLSRLIEKASVNRKPQLPQHFVDAY    211 - 280
LDEMDQGKNDPSSTFSKENLIFSVGELIIAGTETTTNVLRWAILFMALYPNIQGQVQKEIDLIMGPNGKP    281 - 350
SWDDKCKMPYTEAVLHEVLRFCNIVPLGIFHATSEDAVVRGYSIPKGTTVITNLYSVHFDEKYWRDPEVF    351 - 420
HPERFLDSSGYFAKKEALVPFSLGRRHCLGEHLARMEMFLFFTALLQRFHLHFPHELVPDLKPRLGMTLQ    421 - 490
PQPYLICAERR                                                               491 - 501
//

Text Mined References (66)

PMID Year Title