Property Summary

NCBI Gene PubMed Count 8
PubMed Score 11.28
PubTator Score 7.04

Knowledge Summary

Patent

No data available

Expression

Gene RIF (6)

AA Sequence

MLVHTYSAMERPDGLGAAAGGARLSSLPQAAYGPAPPLCHTPAATAAAEFQPPYFPPPYPQPPLPYGQAP      1 - 70
DAAAAFPHLAGDPYGGLAPLAQPQPPQAAWAAPRAAARAHEEPPGLLAPPARALGLDPRRDYATAVPRLL     71 - 140
HGLADGAHGLADAPLGLPGLAAAPGLEDLQAMDEPGMSLLDQSVIKKVPIPSKASSLSALSLAKDSLVGG    141 - 210
ITNPGEVFCSVPGRLSLLSSTSKYKVTVGEVQRRLSPPECLNASLLGGVLRRAKSKNGGRCLRERLEKIG    211 - 280
LNLPAGRRKAANVTLLTSLVEGEAVHLARDFGYVCETEFPAKAAAEYLCRQHADPGELHSRKSMLLAAKQ    281 - 350
ICKEFADLMAQDRSPLGNSRPALILEPGVQSCLTHFSLITHGFGGPAICAALTAFQNYLLESLKGLDKMF    351 - 420
LSSVGSGHGETKASEKDAKHRK                                                    421 - 442
//

Text Mined References (10)

PMID Year Title