Property Summary

NCBI Gene PubMed Count 6
Grant Count 3
R01 Count 3
Funding $176,185.75
PubMed Score 10.12
PubTator Score 7.04

Knowledge Summary

Patent

No data available

Expression

Gene RIF (4)

PMID Text
24996990 AP-2E was frequently hypermethylated in tumors from patients with colorectal cancer
23331625 AP-2epsilon indirectly interacts with the core promoter of COL2A1 and subsequently inhibits its transcriptional activity, thus modulating cartilage development.
22216841 TFAP2E hypermethylation is associated with clinical nonresponsiveness to chemotherapy in colorectal cancer.
20862309 These findings reveal that Tfap2 activity, mediated redundantly by Tfap2a and Tfap2e, promotes melanophore differentiation in parallel with Mitf by an effector other than Kit.

AA Sequence

MLVHTYSAMERPDGLGAAAGGARLSSLPQAAYGPAPPLCHTPAATAAAEFQPPYFPPPYPQPPLPYGQAP      1 - 70
DAAAAFPHLAGDPYGGLAPLAQPQPPQAAWAAPRAAARAHEEPPGLLAPPARALGLDPRRDYATAVPRLL     71 - 140
HGLADGAHGLADAPLGLPGLAAAPGLEDLQAMDEPGMSLLDQSVIKKVPIPSKASSLSALSLAKDSLVGG    141 - 210
ITNPGEVFCSVPGRLSLLSSTSKYKVTVGEVQRRLSPPECLNASLLGGVLRRAKSKNGGRCLRERLEKIG    211 - 280
LNLPAGRRKAANVTLLTSLVEGEAVHLARDFGYVCETEFPAKAAAEYLCRQHADPGELHSRKSMLLAAKQ    281 - 350
ICKEFADLMAQDRSPLGNSRPALILEPGVQSCLTHFSLITHGFGGPAICAALTAFQNYLLESLKGLDKMF    351 - 420
LSSVGSGHGETKASEKDAKHRK                                                    421 - 442
//

Text Mined References (8)

PMID Year Title
24996990 2014 TFAP2E hypermethylation was associated with survival advantage in patients with colorectal cancer.
23331625 2013 The transcription factor activating enhancer-binding protein epsilon (AP-2?) regulates the core promoter of type II collagen (COL2A1).
22216841 2012 TFAP2E-DKK4 and chemoresistance in colorectal cancer.
20862309 2010 Differentiation of zebrafish melanophores depends on transcription factors AP2 alpha and AP2 epsilon.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14636996 2003 Molecular cloning and characterization of AP-2 epsilon, a fifth member of the AP-2 family.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.