Property Summary

NCBI Gene PubMed Count 26
PubMed Score 12.84
PubTator Score 16.66

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
pancreatic ductal adenocarcinoma liver m... 1.875 0.000

Synonym

Accession Q6VMQ6 F5GX74 G3V1U0 Q4G0T9 Q6P3T3 Q86XW5 Q9NVJ9 Q9NWC2 Q9Y4X8
Symbols AM
MCAF
p621
MCAF1
ATF-IP

Gene

PDB

2RPQ  

Gene RIF (12)

PMID Text
26813693 results indicate that ATF7IP does not directly modulate SETDB1 catalytic activity, suggesting alternate roles, such as affecting cellular localization or mediating interaction with additional binding partners.
24598729 these results indicate a critical role for MCAF1 in AP-1-dependent Rta activation of BZLF1 transcription.
24464130 We demonstrated the importance of Aire's interaction with the ATF7ip-MBD1 protein complex in maintaining central tolerance
23935871 The transcriptional cofactor MCAF1/ATF7IP is involved in histone gene expression and cellular senescence.
23359319 Genetic variants at ATF7IP and KLK2 contribute to the variance of %fPSA.
20543847 Studies identified three new susceptibility loci DMRT1, TERT and ATF7IP associated with testicular germ cell cancer.
20543847 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19106100 Two evolutionarily conserved domains of MCAF1 directly interact with Sp1 and the general transcriptional apparatus. Selective depletion of MCAF1 or Sp1 down-regulates TERT and TERC genes in cultured cells, which results in decreased telomerase activity.
18842587 the acidic stretch of the SIM of MCAF1 plays an important role in the binding to SUMO-3.
16757475 MBD1- and MCAF1-mediated heterochromatin formation involves SUMO modification
More...

AA Sequence

MDSLEEPQKKVFKARKTMRVSDRQQLEAVYKVKEELLKTDVKLLNGNHENGDLDPTSPLENMDYIKDKEE      1 - 70
VNGIEEICFDPEGSKAEWKETPCILSVNVKNKQDDDLNCEPLSPHNITPEPVSKLPAEPVSGDPAPGDLD     71 - 140
AGDPASGVLASGDSTSGDPTSSEPSSSDAASGDATSGDAPSGDVSPGDATSGDATADDLSSGDPTSSDPI    141 - 210
PGEPVPVEPISGDCAADDIASSEITSVDLASGAPASTDPASDDLASGDLSSSELASDDLATGELASDELT    211 - 280
SESTFDRTFEPKSVPVCEPVPEIDNIEPSSNKDDDFLEKNGADEKLEQIQSKDSLDEKNKADNNIDANEE    281 - 350
TLETDDTTICSDRPPENEKKVEEDIITELALGEDAISSSMEIDQGEKNEDETSADLVETINENVIEDNKS    351 - 420
ENILENTDSMETDEIIPILEKLAPSEDELTCFSKTSLLPIDETNPDLEEKMESSFGSPSKQESSESLPKE    421 - 490
AFLVLSDEEDISGEKDESEVISQNETCSPAEVESNEKDNKPEEEEQVIHEDDERPSEKNEFSRRKRSKSE    491 - 560
DMDNVQSKRRRYMEEEYEAEFQVKITAKGDINQKLQKVIQWLLEEKLCALQCAVFDKTLAELKTRVEKIE    561 - 630
CNKRHKTVLTELQAKIARLTKRFEAAKEDLKKRHEHPPNPPVSPGKTVNDVNSNNNMSYRNAGTVRQMLE    631 - 700
SKRNVSESAPPSFQTPVNTVSSTNLVTPPAVVSSQPKLQTPVTSGSLTATSVLPAPNTATVVATTQVPSG    701 - 770
NPQPTISLQPLPVILHVPVAVSSQPQLLQSHPGTLVTNQPSGNVEFISVQSPPTVSGLTKNPVSLPSLPN    771 - 840
PTKPNNVPSVPSPSIQRNPTASAAPLGTTLAVQAVPTAHSIVQATRTSLPTVGPSGLYSPSTNRGPIQMK    841 - 910
IPISAFSTSSAAEQNSNTTPRIENQTNKTIDASVSKKAADSTSQCGKATGSDSSGVIDLTMDDEESGASQ    911 - 980
DPKKLNHTPVSTMSSSQPVSRPLQPIQPAPPLQPSGVPTSGPSQTTIHLLPTAPTTVNVTHRPVTQVTTR    981 - 1050
LPVPRAPANHQVVYTTLPAPPAQAPLRGTVMQAPAVRQVNPQNSVTVRVPQTTTYVVNNGLTLGSTGPQL   1051 - 1120
TVHHRPPQVHTEPPRPVHPAPLPEAPQPQRLPPEAASTSLPQKPHLKLARVQSQNGIVLSWSVLEVDRSC   1121 - 1190
ATVDSYHLYAYHEEPSATVPSQWKKIGEVKALPLPMACTLTQFVSGSKYYFAVRAKDIYGRFGPFCDPQS   1191 - 1260
TDVISSTQSS                                                               1261 - 1270
//

Text Mined References (36)

PMID Year Title
26813693 2016 Characterization of the Enzymatic Activity of SETDB1 and Its 1:1 Complex with ATF7IP.
24598729 2014 MCAF1 and Rta-activated BZLF1 transcription in Epstein-Barr virus.
24464130 2014 The transcriptional regulator Aire coopts the repressive ATF7ip-MBD1 complex for the induction of immunotolerance.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24143190 2013 Genome-wide association study of breast cancer in the Japanese population.
23935871 2013 The transcriptional cofactor MCAF1/ATF7IP is involved in histone gene expression and cellular senescence.
23666240 2013 Identification of nine new susceptibility loci for testicular cancer, including variants near DAZL and PRDM14.
23359319 2013 Genome-wide association study identifies loci at ATF7IP and KLK2 associated with percentage of circulating free PSA.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
More...