Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.80

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Synonym

Accession Q6VEQ5
Symbols FAM39B

Gene

 GO Function (1)

AA Sequence

MTPVRMQHSLAGQTYAVPLIQPDLRREEAVQQMADALQYLQKVSGDIFSRISQQVEQSRSQVQAIGEKVS      1 - 70
LAQAKIEKIKGSKKAIKVFSSAKYPAPERLQEYGSIFTGAQDPGLQRRPRHRIQSKHRPLDERALQEKLK     71 - 140
DFPVCVSTKPEPEDDAEEGLGGLPSNISSVSSLLLFNTTENLYKKYVFLDPLAGAVTKTHVMLGAETEEK    141 - 210
LFDAPLSISKREQLEQQVPENYFYVPDLGQVPEIDVPSYLPDLPGIANDLMYIADLGPGIAPSAPGTIPE    211 - 280
LPTFHTEVAEPLKVDLQDGVLTPPPPPPPPPPAPEVLASAPPLPPSTAAPVGQGARQDDSSSSASPSVQG    281 - 350
APREVVDPSGGRATLLESIRQAGGIGKAKLRSMKERKLEKKKQKEQEQVRATSQGGHLMSDLFNKLVMRR    351 - 420
KGISGKGPGAGEGPGGAFARVSDSIPPLPPPQQPQAEEDEDDWES                             421 - 465
//

Text Mined References (7)

PMID Year Title
18159949 2007 Human subtelomeric WASH genes encode a new subclass of the WASP family.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15233989 2004 Diverse fates of paralogs following segmental duplication of telomeric genes.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11701968 2001 Characterization of the murine orthologue of a novel human subtelomeric multigene family.
10655549 2000 Differentially regulated and evolved genes in the fully sequenced Xq/Yq pseudoautosomal region.