Property Summary

NCBI Gene PubMed Count 21
PubMed Score 8.24
PubTator Score 16.29

Knowledge Summary

Patent (2,138)

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
lung carcinoma 2844 1.55158680524817E-37
posterior fossa group A ependymoma 1511 2.82332206081106E-12
pediatric high grade glioma 2712 1.18658290158265E-9
glioblastoma 5572 2.31780197649086E-8
pilocytic astrocytoma 3086 1.92397878991546E-7
medulloblastoma, large-cell 6234 4.15480328723634E-7
group 3 medulloblastoma 2254 4.51617532299339E-7
oligodendroglioma 2849 1.55415091525116E-6
atypical teratoid / rhabdoid tumor 4369 1.29218186203755E-5
primitive neuroectodermal tumor 3031 8.65866071725902E-5
interstitial cystitis 2299 6.21364242865138E-4
astrocytic glioma 2241 0.0088356688283309
subependymal giant cell astrocytoma 2287 0.00941114921042439

Expression

  Differential Expression (13)

Synonym

Accession Q6VAB6 A0PJT2 Q3B828 Q8N775 hKSR2
Symbols

Gene

PDB

2Y4I  

  Ortholog (9)

Gene RIF (13)

PMID Text
24672054 KSR2 deficiency affects stromal interaction molecule 1 (STIM1)/ORAI1 puncta formation, which is correlated with cytoskeleton disorganization.
24209692 Study explored the role of KSR2 in humans by sequencing 2,101 individuals with severe early-onset obesity and identified multiple rare variants in KSR2 that disrupt signaling through the Raf-MEKERK pathway and impair cellular fatty acid oxidation and glucose oxidation in transfected cells.
23303246 study demonstrated that miR-31 upregulated IL-2 expression via reduction of its up-stream kinase suppressor, KSR2, and is a component of T cell activation
21441910 KSR interacts with a regulatory Raf molecule in cis to induce a conformational switch of MEK, facilitating MEK's phosphorylation by a separate catalytic Raf molecule in trans
21403620 The involvement of KSR2 in regulation of cell proliferation was predicted by a KSR2-centered network analysis.
20945381 Oncoprotein Cot1 represses kinase suppressors of Ras1/2 and 1,25-dihydroxyvitamin D3-induced differentiation of human acute myeloid leukemia cells.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19563921 KSR-2 may act as a scaffold protein similar as KSR-1 to mediate the MAPK core (RAF-MEK-ERK) signaling but with a distinct RAF isoform specificity; KSR-2 may only mediate the A-RAF signaling while KSR-1 transduces signals only from c-RAF.
More...

AA Sequence

MDEENMTKSEEQQPLSLQKALQQCELVQNMIDLSISNLEGLRTKCATSNDLTQKEIRTLESKLVKYFSRQ      1 - 70
LSCKKKVALQERNAELDGFPQLRHWFRIVDVRKEVLEEISPGQLSLEDLLEMTDEQVCETVEKYGANREE     71 - 140
CARLNASLSCLRNVHMSGGNLSKQDWTIQWPTTETGKENNPVCPPEPTPWIRTHLSQSPRVPSKCVQHYC    141 - 210
HTSPTPGAPVYTHVDRLTVDAYPGLCPPPPLESGHRSLPPSPRQRHAVRTPPRTPNIVTTVTPPGTPPMR    211 - 280
KKNKLKPPGTPPPSSRKLIHLIPGFTALHRSKSHEFQLGHRVDEAHTPKAKKKSKPLNLKIHSSVGSCEN    281 - 350
IPSQQRSPLLSERSLRSFFVGHAPFLPSTPPVHTEANFSANTLSVPRWSPQIPRRDLGNSIKHRFSTKYW    351 - 420
MSQTCTVCGKGMLFGLKCKNCKLKCHNKCTKEAPPCHLLIIHRGDPARLVRTESVPCDINNPLRKPPRYS    421 - 490
DLHISQTLPKTNKINKDHIPVPYQPDSSSNPSSTTSSTPSSPAPPLPPSATPPSPLHPSPQCTRQQKNFN    491 - 560
LPASHYYKYKQQFIFPDVVPVPETPTRAPQVILHPVTSNPILEGNPLLQIEVEPTSENEEVHDEAEESED    561 - 630
DFEEMNLSLLSARSFPRKASQTSIFLQEWDIPFEQLEIGELIGKGRFGQVYHGRWHGEVAIRLIDIERDN    631 - 700
EDQLKAFKREVMAYRQTRHENVVLFMGACMSPPHLAIITSLCKGRTLYSVVRDAKIVLDVNKTRQIAQEI    701 - 770
VKGMGYLHAKGILHKDLKSKNVFYDNGKVVITDFGLFSISGVLQAGRREDKLRIQNGWLCHLAPEIIRQL    771 - 840
SPDTEEDKLPFSKHSDVFALGTIWYELHAREWPFKTQPAEAIIWQMGTGMKPNLSQIGMGKEISDILLFC    841 - 910
WAFEQEERPTFTKLMDMLEKLPKRNRRLSHPGHFWKSAEL                                  911 - 950
//

Text Mined References (23)

PMID Year Title
24672054 2014 The KSR2-calcineurin complex regulates STIM1-ORAI1 dynamics and store-operated calcium entry (SOCE).
24209692 2013 KSR2 mutations are associated with obesity, insulin resistance, and impaired cellular fuel oxidation.
23793025 2013 Genome-wide meta-analysis identifies new susceptibility loci for migraine.
23472165 2013 Genome-wide association study link novel loci to endometriosis.
23303246 2013 miR-31 regulates interleukin 2 and kinase suppressor of ras 2 during T cell activation.
22589738 2012 Genome-wide association for abdominal subcutaneous and visceral adipose reveals a novel locus for visceral fat in women.
21441910 2011 A Raf-induced allosteric transition of KSR stimulates phosphorylation of MEK.
21403620 2010 Kinase suppressor of Ras 2 is involved in regulation of cell proliferation and is up-regulated in human invasive ductal carcinomas of breast.
20945381 2011 Oncoprotein Cot1 represses kinase suppressors of Ras1/2 and 1,25-dihydroxyvitamin D3-induced differentiation of human acute myeloid leukemia cells.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
More...