Property Summary

NCBI Gene PubMed Count 24
PubMed Score 8.77
PubTator Score 16.29

Knowledge Summary

Patent (2,138)

Expression

  Differential Expression (13)

Disease log2 FC p
adult high grade glioma -3.200 2.1e-06
astrocytic glioma -1.700 8.8e-03
Astrocytoma, Pilocytic -2.600 2.4e-07
atypical teratoid / rhabdoid tumor -2.900 1.3e-05
ependymoma -1.400 2.9e-02
glioblastoma -3.200 1.4e-10
group 3 medulloblastoma -4.300 4.5e-07
interstitial cystitis -2.100 6.2e-04
lung carcinoma 2.000 1.6e-37
medulloblastoma, large-cell -3.700 4.2e-07
oligodendroglioma -1.200 1.6e-06
primitive neuroectodermal tumor -2.600 8.7e-05
subependymal giant cell astrocytoma -2.954 9.4e-03

Gene RIF (14)

AA Sequence

MDEENMTKSEEQQPLSLQKALQQCELVQNMIDLSISNLEGLRTKCATSNDLTQKEIRTLESKLVKYFSRQ      1 - 70
LSCKKKVALQERNAELDGFPQLRHWFRIVDVRKEVLEEISPGQLSLEDLLEMTDEQVCETVEKYGANREE     71 - 140
CARLNASLSCLRNVHMSGGNLSKQDWTIQWPTTETGKENNPVCPPEPTPWIRTHLSQSPRVPSKCVQHYC    141 - 210
HTSPTPGAPVYTHVDRLTVDAYPGLCPPPPLESGHRSLPPSPRQRHAVRTPPRTPNIVTTVTPPGTPPMR    211 - 280
KKNKLKPPGTPPPSSRKLIHLIPGFTALHRSKSHEFQLGHRVDEAHTPKAKKKSKPLNLKIHSSVGSCEN    281 - 350
IPSQQRSPLLSERSLRSFFVGHAPFLPSTPPVHTEANFSANTLSVPRWSPQIPRRDLGNSIKHRFSTKYW    351 - 420
MSQTCTVCGKGMLFGLKCKNCKLKCHNKCTKEAPPCHLLIIHRGDPARLVRTESVPCDINNPLRKPPRYS    421 - 490
DLHISQTLPKTNKINKDHIPVPYQPDSSSNPSSTTSSTPSSPAPPLPPSATPPSPLHPSPQCTRQQKNFN    491 - 560
LPASHYYKYKQQFIFPDVVPVPETPTRAPQVILHPVTSNPILEGNPLLQIEVEPTSENEEVHDEAEESED    561 - 630
DFEEMNLSLLSARSFPRKASQTSIFLQEWDIPFEQLEIGELIGKGRFGQVYHGRWHGEVAIRLIDIERDN    631 - 700
EDQLKAFKREVMAYRQTRHENVVLFMGACMSPPHLAIITSLCKGRTLYSVVRDAKIVLDVNKTRQIAQEI    701 - 770
VKGMGYLHAKGILHKDLKSKNVFYDNGKVVITDFGLFSISGVLQAGRREDKLRIQNGWLCHLAPEIIRQL    771 - 840
SPDTEEDKLPFSKHSDVFALGTIWYELHAREWPFKTQPAEAIIWQMGTGMKPNLSQIGMGKEISDILLFC    841 - 910
WAFEQEERPTFTKLMDMLEKLPKRNRRLSHPGHFWKSAEL                                  911 - 950
//

Text Mined References (26)

PMID Year Title