Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.09

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (4)

Disease log2 FC p
ependymoma 1.800 2.6e-04
facioscapulohumeral dystrophy -2.700 4.7e-05
lung carcinoma -1.200 1.9e-03
nasopharyngeal carcinoma -2.300 6.9e-08

Gene RIF (2)

AA Sequence

MDQEEGLKALDNIVTQFNAYEDFLDSQITTVDLYYLEDETLARQLVELGYRGTGERVKREDFEARKAAIE      1 - 70
IARLAERAQQKTLTSAGKDLQDNFLTALAMREEDNRSGKLSSVIFIRDRNSHGQEISGYIDYAHRLKTED     71 - 140
FEVYFTGKKRLLPRPTDISFYNWDADIAVSNSSPNYQVIADNPEGLLFRYKRDRKILNVDPKAQPGDNST    141 - 210
RITILTELYVQAVIFDHISRRKT                                                   211 - 233
//

Text Mined References (7)

PMID Year Title