Property Summary

NCBI Gene PubMed Count 27
Grant Count 1
Funding $14,172.5
PubMed Score 71.81
PubTator Score 58.22

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q6V1X1 Q7Z4C8 Q7Z4D3 Q7Z4E1 Q8IWG7 Q8NEM5 Q96JX1 Q9HBM2 Q9HBM3 Q9HBM4 Q9HBM5 Q9NXF4 DP8
Symbols DP8
DPRP1
DPRP-1
MST097
MSTP097
MSTP135
MSTP141

Gene

PANTHER Protein Class (3)

 Grant Application (1)

Gene RIF (14)

PMID Text
25464020 The DPP8 expressing cell model system is a very useful and promising system for investigating the selectivity and associated toxicity of DPP4 inhibitors on DPP8.
24072711 The SUMO1-E67 interacting loop peptide is an allosteric inhibitor of the dipeptidyl peptidases 8 and 9.
23704821 Suggest roles for DPP8 and DPP9 in lymphocyte activation and apoptosis and in hepatocytes during liver disease pathogenesis.
23608773 DPP8 was found in macrophages of carotid atherosclerotic plaque and may play a role in disease progression.
23519473 analysis of dipeptidyl peptidases 8 and 9 reveals that they may have compensatory roles
22736146 this study demonstrates for the first time that DP8 and DP9 are expressed in breast and ovarian carcinoma cell lines
21711053 Data identify modification points in the topology of a representative DPP8/9-inhibitor, capable of rendering selectivity for DPP8 over DPP9.
20534982 This is the first study to demonstrate the presence of DP8 in chronic lymphocytic leukemia (CLL) and the upregulation of DP8 mRNA in CLL.
20043068 DPP8 and DPP9 prevail over canonical DPP-IV/CD26 and FAPalpha in all examined meningioma patients
19581630 DP8 and DP9 tissue and cellular expression
More...

AA Sequence

MWKRSEQMKIKSGKCNMAAAMETEQLGVEIFETADCEENIESQDRPKLEPFYVERYSWSQLKKLLADTRK      1 - 70
YHGYMMAKAPHDFMFVKRNDPDGPHSDRIYYLAMSGENRENTLFYSEIPKTINRAAVLMLSWKPLLDLFQ     71 - 140
ATLDYGMYSREEELLRERKRIGTVGIASYDYHQGSGTFLFQAGSGIYHVKDGGPQGFTQQPLRPNLVETS    141 - 210
CPNIRMDPKLCPADPDWIAFIHSNDIWISNIVTREERRLTYVHNELANMEEDARSAGVATFVLQEEFDRY    211 - 280
SGYWWCPKAETTPSGGKILRILYEENDESEVEIIHVTSPMLETRRADSFRYPKTGTANPKVTFKMSEIMI    281 - 350
DAEGRIIDVIDKELIQPFEILFEGVEYIARAGWTPEGKYAWSILLDRSQTRLQIVLISPELFIPVEDDVM    351 - 420
ERQRLIESVPDSVTPLIIYEETTDIWINIHDIFHVFPQSHEEEIEFIFASECKTGFRHLYKITSILKESK    421 - 490
YKRSSGGLPAPSDFKCPIKEEIAITSGEWEVLGRHGSNIQVDEVRRLVYFEGTKDSPLEHHLYVVSYVNP    491 - 560
GEVTRLTDRGYSHSCCISQHCDFFISKYSNQKNPHCVSLYKLSSPEDDPTCKTKEFWATILDSAGPLPDY    561 - 630
TPPEIFSFESTTGFTLYGMLYKPHDLQPGKKYPTVLFIYGGPQVQLVNNRFKGVKYFRLNTLASLGYVVV    631 - 700
VIDNRGSCHRGLKFEGAFKYKMGQIEIDDQVEGLQYLASRYDFIDLDRVGIHGWSYGGYLSLMALMQRSD    701 - 770
IFRVAIAGAPVTLWIFYDTGYTERYMGHPDQNEQGYYLGSVAMQAEKFPSEPNRLLLLHGFLDENVHFAH    771 - 840
TSILLSFLVRAGKPYDLQIYPQERHSIRVPESGEHYELHLLHYLQENLGSRIAALKVI                841 - 898
//

Text Mined References (27)

PMID Year Title
25464020 Establishment of a dipeptidyl peptidases (DPP) 8/9 expressing cell model for evaluating the selectivity of DPP4 inhibitors.
24072711 2013 The SUMO1-E67 interacting loop peptide is an allosteric inhibitor of the dipeptidyl peptidases 8 and 9.
23704821 2013 Regulation of dipeptidyl peptidase 8 and 9 expression in activated lymphocytes and injured liver.
23608773 2013 Dipeptidyl peptidases in atherosclerosis: expression and role in macrophage differentiation, activation and apoptosis.
23519473 2013 Identifying natural substrates for dipeptidyl peptidases 8 and 9 using terminal amine isotopic labeling of substrates (TAILS) reveals in vivo roles in cellular homeostasis and energy metabolism.
22736146 2012 Expression profiling of dipeptidyl peptidase 8 and 9 in breast and ovarian carcinoma cell lines.
21711053 2011 Structure-activity relationship studies on isoindoline inhibitors of dipeptidyl peptidases 8 and 9 (DPP8, DPP9): is DPP8-selectivity an attainable goal?
20534982 2010 Expression and prognostic assessment of dipeptidyl peptidase IV and related enzymes in B-cell chronic lymphocytic leukemia.
20139978 2010 Genome-wide association study of hematological and biochemical traits in a Japanese population.
20043068 2010 Expression of dipeptidyl peptidase-IV activity and/or structure homologs in human meningiomas.
More...