Property Summary

NCBI Gene PubMed Count 10
PubMed Score 8.71
PubTator Score 8.12

Knowledge Summary

Patent

No data available

Expression

Gene RIF (8)

AA Sequence

MFPWGLSCLSVLGAAGTALLCAGLLLSLAQHLWTLRWMLSRDRASTLPLPKGSMGWPFFGETLHWLVQGS      1 - 70
RFHSSRRERYGTVFKTHLLGRPVIRVSGAENVRTILLGEHRLVRSQWPQSAHILLGSHTLLGAVGEPHRR     71 - 140
RRKVLARVFSRAALERYVPRLQGALRHEVRSWCAAGGPVSVYDASKALTFRMAARILLGLRLDEAQCATL    141 - 210
ARTFEQLVENLFSLPLDVPFSGLRKGIRARDQLHRHLEGAISEKLHEDKAAEPGDALDLIIHSARELGHE    211 - 280
PSMQELKESAVELLFAAFFTTASASTSLVLLLLQHPAAIAKIREELVAQGLGRACGCAPGAAGGSEGPPP    281 - 350
DCGCEPDLSLAALGRLRYVDCVVKEVLRLLPPVSGGYRTALRTFELDGYQIPKGWSVMYSIRDTHETAAV    351 - 420
YRSPPEGFDPERFGAAREDSRGASSRFHYIPFGGGARSCLGQELAQAVLQLLAVELVRTARWELATPAFP    421 - 490
AMQTVPIVHPVDGLRLFFHPLTPSVAGNGLCL                                          491 - 522
//

Text Mined References (10)

PMID Year Title