Property Summary

NCBI Gene PubMed Count 16
PubMed Score 7.89
PubTator Score 5.52

Knowledge Summary

Patent

No data available

TINX Plot

Expression

Gene RIF (4)

AA Sequence

MASPAPLVASISHQMVALQTLQLLQQEWGWGDGPVAPGNPRDPDHVSTAPARRSGPPRARPGPGREERGG      1 - 70
GVGTRSRRTAARANSPEEEVVRGAEGGAELLPFPRDRGPCTLAQMAMRSALARVVDSTSELVSVEQTLLG     71 - 140
PLQQERSFPIHLKDSVEFRNICSHLALQIEGQQFDRDLNAAHQCLKTIVKKLIQSLANFPSDAHMVACAS    141 - 210
LRQILQNLPDI                                                               211 - 221
//

Text Mined References (16)

PMID Year Title